KEGG   Mus musculus (mouse): 239833Help
Entry
239833            CDS       T01002                                 

Gene name
Lmln, 5330415H22Rik, AI465495
Definition
(RefSeq) leishmanolysin-like (metallopeptidase M8 family)
  KO
K13539  leishmanolysin-like peptidase [EC:3.4.24.-]
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:mmu01002]
    239833 (Lmln)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mmu03036]
    239833 (Lmln)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.-  
     239833 (Lmln)
Peptidases [BR:mmu01002]
 Metallo Peptidases
  Family M8: leishmanolysin family
   239833 (Lmln)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Other centrosome duplication proteins
     239833 (Lmln)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M8 Acetyltransf_3
Motif
Other DBs
NCBI-GeneID: 239833
NCBI-ProteinID: NP_766411
MGI: 2444736
Ensembl: ENSMUSG00000022802
Vega: OTTMUSG00000026934
UniProt: Q8BMN4
Position
16; 16 B3
AA seq 681 aa AA seqDB search
MAAAGSGGAGGPGPGPRGRWGGCLWVRGVLLVLGGLPAGAGAAPVSLGTSPPCRHHVLSD
TEVINKVHLKTNHVTKRDADGHLRIKTIYDQSIEELLPEKRYLVKNKLFPQAISYLEKTF
QVRRPAGRILLSRQCATNQYLRKENDPHRYCTGECAVHTKCGPVIVPEEHLQQCRVCREG
KWPCGAVGVLDPEGVRDADFVLYVGALATERCSHENIISYAAYCQQEAKMDRPIAGYANL
CPNMISTQPQEFIGMLSTVKHEIIHALGFSAGLFAFYHDQDGNPLTSRSADGLPPFNYSL
GLYQWSDKVVRKVERLWNVRDNKIVRHTVYLLVTPRVVEEARKHFNCPVLEGMELENQGG
MGTELNHWEKRLLENEAMTGSHTQNRVLSRITLALMEDTGWYKANYSMAEKLDWGRGLGC
EFVRKSCKFWIDQHRQRRQVPSPYCDTLRSNPLQLTCRQDQRAVAVCNLQRFPNPLPPEY
QYFDELTGIPAEDLPYYGGSVEIADYCPFSQEFSWHLSGEYQRSSDCRILENQPELFKNY
GAEQYGPHSVCLLQKSAFIMEQCERKLSYPDWGSGCYQVSCSPQGLKVWVQDTSYLCSRA
GQVLPVRIQMNGWIHNGNLLCPSCWDFCEQCPPETDPPAANLTRALPLDLCSCSSSLVVT
LWLLLGNLFPLLAGFLLCVWH
NT seq 2046 nt NT seq  +upstreamnt  +downstreamnt
atggcggccgctgggtctggaggagcgggcggcccgggaccagggccgcgaggccgctgg
ggcggctgcctgtgggtgcgaggcgtcctgcttgtgctgggcgggctcccggccggtgcc
ggagctgctcccgtctccctgggcacttcgcctccgtgtcgccatcacgtcctttcggac
actgaggtcataaataaggtccatcttaagacaaatcatgtcacgaagagagatgctgac
gggcatttacgaatcaagaccatctacgaccagagcattgaagagttgctccctgagaaa
agatatcttgtaaagaacaaacttttccctcaagctatttcttatttagagaaaacattt
caggttcgaagacctgctggcaggatcttacttagcagacaatgtgcgacaaaccagtac
ctacggaaggaaaacgatccacacagatactgtactggagagtgtgcggtgcataccaag
tgcgggcctgttatagtgccggaggagcacctccagcaatgcagggtctgccgagagggt
aagtggccgtgtggagcagtgggtgtgcttgacccagagggtgtgcgggacgcagacttc
gttctttatgtgggtgctctggccactgagaggtgcagccacgaaaacatcatctcctac
gcagcctattgtcagcaggaggcaaaaatggacaggcccatagcaggatatgctaacctg
tgtccaaatatgatctccacccagccccaggagttcatcgggatgctgtccacagtgaag
catgagatcattcatgccctgggcttctctgctggtctttttgcattctaccatgatcaa
gatggaaaccccctgacttcaaggtctgcagatggcctcccgcccttcaactatagtctt
ggcttgtatcagtggagtgataaagtggttcggaaagtggagagattgtggaatgttcga
gataacaagatagttcgccacactgtgtatctcctagtaacaccgcgtgttgttgaagaa
gctcggaagcattttaactgtccggtcctcgagggcatggagcttgaaaaccaaggcggg
atgggcacggagctgaaccactgggagaagcgcttgctcgagaatgaagcaatgactggt
tcccacacccagaacagagtcctgtctcggatcactctggcgttaatggaggacactggc
tggtacaaagccaattacagcatggctgagaaactcgactggggccgaggactgggctgt
gaatttgtcaggaagagctgtaaattctggattgatcagcacaggcaaaggaggcaggtg
ccgagcccgtactgtgacacactcagaagtaacccgctgcagctgacctgcagacaggac
cagagagccgtcgctgtgtgtaacctgcagaggtttcctaaccccttaccacccgagtac
cagtactttgatgagctcactgggatacctgcggaggatctgccttactatggcgggtct
gtggaaatcgctgactattgtcctttcagtcaggaattcagctggcatttaagtggcgaa
taccagcgcagctccgactgtagaatcctggaaaaccaaccagagctgtttaagaactac
ggggcagagcagtacgggccgcactcggtctgtctgcttcagaagtctgcgttcatcatg
gagcagtgcgagaggaagctcagctacccagactgggggagcggctgctaccaggtttct
tgttctcctcaaggtctaaaggtttgggttcaagacacttcctatctgtgtagccgggcc
gggcaggtgctcccagtccgaattcagatgaacggctggattcacaatggaaacctgctg
tgcccttcctgctgggacttctgtgagcagtgtccaccagaaacagaccctccagctgcc
aacctgactcgagcccttcctctggatctctgttcctgctcttctagcctggtggtcaca
ctttggctcctcctcggcaatctgtttcctctgctggcggggttccttctgtgtgtgtgg
cactag

DBGET integrated database retrieval system