KEGG   Mus musculus (house mouse): 239852
Entry
239852            CDS       T01002                                 
Symbol
Zpld1, 9430016A21Rik
Name
(RefSeq) zona pellucida like domain containing 1
Organism
mmu  Mus musculus (house mouse)
SSDB
Motif
Pfam: Zona_pellucida
Other DBs
NCBI-GeneID: 239852
NCBI-ProteinID: NP_848835
MGI: 2443415
Ensembl: ENSMUSG00000064310
UniProt: Q8BGZ8
Position
16:complement(55044488..55142403)
AA seq 415 aa
MERVWLLFLLAIRVSPGSAQFNSYNCDANLHSRFPAERDISVYCGVQAITMKINFCTVLF
SGYSETDLALNGRHGDSHCRGFINNNTFPAVVIFIINLSTLEGCGNNLVVSTIPGVGASG
NATTVQIGNISGYIDTPDPPAVISYLPGLLYKFSCSYPLEYLVNNTQLASSSAAISVREN
NGTFVSTLNLLLYNDSTYREQLIIPSIGLPLKTKVFAAVQATNLDGRWNVLMDYCYTTPS
GNPNDDTRYDLFLSCDKDPQTTVIENGRSQRGRFSFEVFRFVKHKNQKMSTVFLHCLTKL
CRADDCPLLMPICGNRKRRDAQSWTTWAPQSTSGNAVLSAGPIITRSDETPTNNSQLGSL
SVPPFQLNAVTSSLISGMVILGVLCFSLLLCSLALLHRKGSTSLVLNGVRNPVFE
NT seq 1248 nt   +upstreamnt  +downstreamnt
atggaacgagtatggttgctgttccttctagcgattagagtgagtccagggtctgctcag
ttcaacagttacaactgtgatgccaacctccacagcagatttcctgcggaaagagacatc
agtgtctactgtggagtgcaggccattacgatgaagattaatttttgcacggtccttttc
tcgggatattcagaaacagatctggcactgaatggaagacatggggattcccactgcagg
ggcttcatcaataacaacacctttccagcagtggtcattttcatcattaatctcagcacc
ttggagggctgtggaaacaatttagtggtgtccacaattcctggtgttggtgcttctgga
aatgctaccacagtacagataggaaatatttctggatatattgatactccggaccctcca
gcagttatcagctatcttcctgggcttctttacaaatttagttgtagttatccgttggaa
tacctggttaataacacccagcttgcttcgtcctcagctgctatttctgtgagagagaac
aatgggacatttgtcagtactttgaacttgctcctttataacgattcaacctacagggag
caattaattatcccgagtataggattacccttgaaaaccaaagtgtttgcagctgtgcaa
gctactaatctggatggcagatggaatgttttaatggattattgctacacaaccccatct
gggaatccaaatgatgatactcggtatgatctcttccttagctgtgacaaagatcctcag
accactgtcatcgaaaatggcagaagccagcgaggccggttttcatttgaagtcttccgt
tttgtgaaacacaagaatcaaaagatgtccactgtgttcctgcactgcctcacgaaactc
tgcagagctgatgactgtcctcttctcatgccaatttgtggcaacagaaaaaggagagat
gctcagagctggacaacgtgggccccgcagagcacttctggaaatgcggtcctgtctgca
ggacccatcatcacccggagcgatgagactccaaccaacaattcacagcttggttcgctg
agtgtgcctccctttcagctgaatgccgtcaccagctctctgatatcaggaatggtcatt
ctgggagtcctgtgtttctctctcctcttgtgttcactggcccttctacaccgaaaggga
tctaccagcttggtattgaatggtgtaagaaatcctgtctttgagtga

DBGET integrated database retrieval system