KEGG   Mus musculus (mouse): 23986
Entry
23986             CDS       T01002                                 

Gene name
Eci2, ACBD, Acbd2, DR, Drs1, HCA8, Hca88, Pe, Peci
Definition
(RefSeq) enoyl-Coenzyme A delta isomerase 2
  KO
K13239  Delta3-Delta2-enoyl-CoA isomerase [EC:5.3.3.8]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00071  Fatty acid degradation
mmu04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    23986 (Eci2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    23986 (Eci2)
Enzymes [BR:mmu01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.8  Delta3-Delta2-enoyl-CoA isomerase
     23986 (Eci2)
SSDB
Motif
Pfam: ECH_1 ACBP ECH_2
Other DBs
NCBI-GeneID: 23986
NCBI-ProteinID: NP_001103801
MGI: 1346064
Ensembl: ENSMUSG00000021417
Vega: OTTMUSG00000035939
UniProt: Q9WUR2
Position
13; 13 A3.3
AA seq 391 aa
MAAVTWSRARCWCPSVLQVFRLQVAKLHLGRPTMRASQQDFENALNQVKLLKKDPGNEVK
LRLYALYKQATEGPCNMPKPGMLDFVNKAKWDAWNALGSLPKETARQNYVDLVSSLSSSS
EAPSQGKRGADEKARESKDILVTSEDGITKITFNRPTKKNAISFQMYRDIILALKNASTD
NTVMAVFTGTGDYYCSGNDLTNFTSATGGIEEAASNGAVLLRDFVNSFIDFPKPLVAVVN
GPAVGISVTLLGLFDAVFASDRATFHTPFSQLGQSPEACSSYTFPKMMGSAKAAEMLLFG
KKLTAREAWAQGLVTEVFPESTFETEVWTRLKTYAKLPPNAMRISKELIRKNEKEKLYAV
NAEECTTLQARWLSEECMNAIMSFVSRKPKL
NT seq 1176 nt   +upstreamnt  +downstreamnt
atggcggcagtgacctggagtcgggctcgatgctggtgtccgagtgtcctgcaggtcttc
agattacaagtggctaaactgcacttgggcagaccaacaatgagagccagtcagcaggac
tttgaaaatgcattgaaccaggtgaaactcttgaagaaggacccgggaaacgaagtgaag
ctaagactctatgcactgtacaagcaggccacagaaggaccctgtaatatgcctaagcct
ggtatgcttgactttgtcaacaaagccaagtgggatgcatggaatgccctgggcagccta
cccaaggaaactgccaggcagaactatgtggatctcgtatccagtttgagttcctcatct
gaagccccgagccagggaaagcgtggagctgatgagaaagcccgggagtccaaagacatc
ctggtaacttctgaagatggtatcacgaagatcacgttcaatcggcccaccaaaaagaat
gccatatccttccagatgtatcgggatattatactcgcacttaaaaatgccagcactgat
aacactgtcatggctgttttcacaggaactggtgactactactgcagtgggaatgacctg
actaacttcactagtgccactggggggatagaggaggcagctagcaacggtgctgtgtta
ctgagggactttgtaaacagttttatagactttcccaagcctctggttgcggtagtaaat
ggcccagctgtgggaatctctgtcacccttctgggactatttgatgctgtctttgcatca
gacagggcaacgtttcatactccattcagccaactcggccagagcccggaagcatgctcc
tcttacacgtttccgaagatgatgggctcagcaaaggcagctgagatgcttctctttggg
aagaagctgacagcaagagaggcctgggctcaaggccttgtcactgaagttttccctgag
agcacttttgagacagaagtctggaccaggctgaaaacatatgcgaagctcccgccaaac
gccatgagaatttccaaagagttaatcagaaaaaatgagaaagaaaagctctacgcagtc
aacgctgaagagtgcactactctgcaagcaaggtggctgtcagaggagtgcatgaacgca
atcatgagcttcgtctccagaaaaccaaagctgtga

KEGG   Mus musculus (mouse): 69123
Entry
69123             CDS       T01002                                 

Gene name
Eci3, 1810022C23Rik, Kseg2
Definition
(RefSeq) enoyl-Coenzyme A delta isomerase 3
  KO
K13239  Delta3-Delta2-enoyl-CoA isomerase [EC:5.3.3.8]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00071  Fatty acid degradation
mmu04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    69123 (Eci3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    69123 (Eci3)
Enzymes [BR:mmu01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.8  Delta3-Delta2-enoyl-CoA isomerase
     69123 (Eci3)
SSDB
Motif
Pfam: ECH_1 ECH_2 ACBP Alg14 NYN
Other DBs
NCBI-GeneID: 69123
NCBI-ProteinID: NP_081223
MGI: 1916373
Ensembl: ENSMUSG00000021416
Vega: OTTMUSG00000035929
UniProt: Q78JN3
Position
13; 13 A3.3
AA seq 317 aa
MPKPGVFNFVNKATWDARNALGSLPKETARKNYVDLVSSLSSSSEAPSQGKRGADEKARE
SKDILVTSEDGITKITFNRPTKKNAISFQMYLDIMHALKNASTDNSVITVFTGTGDYYSS
GNDLKNLINDAGEIQDVVATSTKILREFVNCFIDFPKPLVAVVNGPAVGIAVTILALFDA
VFASDRATFHTPFSQLSQIPEACSTYMFPKIMGPTKAAEMLLFGKKLTAREAWAQGLVTE
VFPESTFETEVWTRLKTYSKLSPNVMRISKELIRKHEKQKLYTVNAEECAAALERMPREE
YAKALRNFLFRKAKAKL
NT seq 954 nt   +upstreamnt  +downstreamnt
atgcctaagcctggtgtgtttaactttgtcaacaaagccacgtgggatgcaagaaatgcc
ctgggcagcctacccaaggaaactgccaggaagaactatgtggatctcgtatccagtttg
agttcctcatctgaagccccgagccagggaaagcgtggagctgatgagaaagcccgggag
tccaaagacatcctggtaacttctgaagatggcatcacaaagatcacgttcaatcggccc
accaaaaagaatgccatatccttccagatgtatctggatattatgcatgcacttaaaaat
gccagcacggataactcagtcataactgttttcacaggaactggtgactactacagcagt
gggaatgacctaaaaaacttgattaatgacgctggtgaaatacaggacgtagtagccacg
tctactaagatactgagggaatttgtaaactgttttatagactttccgaagcctctggtt
gcagtagtaaatggcccagctgtgggaatcgctgtcaccatcctggcactatttgatgct
gtctttgcttcggacagggcaacgtttcatactccattcagccaactcagccagatcccg
gaagcatgctccacatacatgtttccaaagataatgggcccaacaaaggcagctgagatg
cttctctttgggaagaagctcacagcaagagaggcctgggctcaaggccttgtcactgaa
gttttccctgagagcacttttgagacagaagtctggaccaggctgaaaacatattcgaag
ctctcgccaaacgtgatgagaatttccaaagagttaatcagaaaacatgagaaacaaaag
ctatacaccgtgaatgccgaagagtgcgctgcagccctggaaaggatgccgagagaggag
tatgcgaaggcactcaggaacttcctgttcagaaaggcaaaggctaagctatga

DBGET integrated database retrieval system