KEGG   Mus musculus (mouse): 23996
Entry
23996             CDS       T01002                                 

Symbol
Psmc4, CIP21, MIP224
Name
(RefSeq) proteasome (prosome, macropain) 26S subunit, ATPase, 4
  KO
K03063  26S proteasome regulatory subunit T3
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03050  Proteasome
mmu05010  Alzheimer disease
mmu05012  Parkinson disease
mmu05014  Amyotrophic lateral sclerosis
mmu05016  Huntington disease
mmu05017  Spinocerebellar ataxia
mmu05020  Prion disease
mmu05022  Pathways of neurodegeneration - multiple diseases
mmu05169  Epstein-Barr virus infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    23996 (Psmc4)
 09160 Human Diseases
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    23996 (Psmc4)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    23996 (Psmc4)
   05012 Parkinson disease
    23996 (Psmc4)
   05014 Amyotrophic lateral sclerosis
    23996 (Psmc4)
   05016 Huntington disease
    23996 (Psmc4)
   05017 Spinocerebellar ataxia
    23996 (Psmc4)
   05020 Prion disease
    23996 (Psmc4)
   05022 Pathways of neurodegeneration - multiple diseases
    23996 (Psmc4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:mmu03051]
    23996 (Psmc4)
Proteasome [BR:mmu03051]
 Eukaryotic proteasome
  Regulatory particles
   PA700 (19S proteasome)
    ATPase subunits
     23996 (Psmc4)
SSDB
Motif
Pfam: AAA Prot_ATP_ID_OB AAA_lid_3 AAA_2 AAA_5 AAA_16 RuvB_N DUF815 AAA_22 RNA_helicase AAA_14 Mg_chelatase AAA_28 NTPase_1 AAA_18 AAA_33 Sigma54_activat NACHT TIP49 CENP-F_leu_zip AAA_3 IstB_IS21 AAA_7 TsaE ATPase_2 Zeta_toxin AAA_24 AAA_25 AAA_17 NB-ARC Parvo_NS1 DUF3450 ABC_tran AAA_30
Other DBs
NCBI-GeneID: 23996
NCBI-ProteinID: NP_036004
MGI: 1346093
Ensembl: ENSMUSG00000030603
Vega: OTTMUSG00000025054
UniProt: P54775
Structure
PDB: 
3AJI

Position
7 A3; 7 16.11 cM
AA seq 418 aa
MEEIGILVEKIQDEIPALSVSRPQTGLSFLGPEPEDLEDLYSRYKKLQQELEFLEVQEEY
IKDEQKNLKKEFLHAQEEVKRIQSIPLVIGQFLEAVDQNTAIVGSTTGSNYYVRILSTID
RELLKPNASVALHKHSNALVDVLPPEADSSIMMLTSDQKPDVMYADIGGMDIQKQEVREA
VELPLTHFELYKQIGIDPPRGVLMYGPPGCGKTMLAKAVAHHTTAAFIRVVGSEFVQKYL
GEGPRMVRDVFRLAKENAPAIIFIDEIDAIATKRFDAQTGADREVQRILLELLNQMDGFD
QNVNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPDRRQKRLIFSTITSKMNLSEEVDL
EDYVARPDKISGADINSICQESGMLAVRENRYIVLAKDFEKAYKTVIKKDEQEHEFYK
NT seq 1257 nt   +upstreamnt  +downstreamnt
atggaggagataggcattttggtggaaaagattcaggatgagattccagcactgtccgtg
tctcggccgcagaccggcctgtcctttctgggacccgaacctgaagacctggaggacctg
tacagccgctacaagaagctgcagcaggagctggagttcctggaagtgcaggaggagtat
atcaaggacgagcagaagaacctgaagaaggaattcctccacgcccaggaggaggtgaag
cggatccagagcatccccttggtcatcggtcagttcttggaagctgtggatcagaacaca
gccatcgtgggctccaccacaggctctaactattatgtgcgcatcctgagtaccatcgac
cgggagctgctcaagcccaacgcctcggtggccctgcacaagcacagcaatgccctggtg
gacgtgctgcctcccgaggccgacagcagcatcatgatgctcacctcagaccagaagcca
gatgtgatgtatgccgatatcggaggcatggacatccagaagcaggaggtgagggaggct
gtggaactcccgcttacacacttcgagctgtacaagcagattggcatcgatcctccccga
ggtgtcctcatgtatggccctcctggctgtggaaagacaatgttagcaaaggctgtggca
catcacacgacagctgcatttatccgtgtggtgggctcggagtttgttcagaagtacctg
ggtgagggcccccggatggtccgggatgtgttccgcctagctaaggagaatgcacctgcc
atcatcttcatagatgaaattgatgccattgccaccaagagattcgatgcccagacagga
gctgacagggaggttcagaggatcctgctggaactactgaatcaaatggatggatttgac
cagaacgtcaatgtgaaggtaatcatggccacaaacagagcagacaccttggatccagct
ctactgcggccaggacgcctggaccgaaaaattgaattcccactccctgaccgtcgccag
aagaggttgattttctccaccatcaccagcaaaatgaacctctctgaggaggtcgacctg
gaagactatgtggcccgtccagataagatttcaggagccgatatcaactccatctgtcag
gagagtggaatgttggctgtccgtgagaaccgctacattgtcctggccaaggacttcgag
aaagcatacaagaccgtgatcaagaaagatgaacaggaacatgaattttacaagtga

DBGET integrated database retrieval system