KEGG   Mus musculus (mouse): 23997
Entry
23997             CDS       T01002                                 

Gene name
Psmd13, S11
Definition
(RefSeq) proteasome (prosome, macropain) 26S subunit, non-ATPase, 13
  KO
K03039  26S proteasome regulatory subunit N9
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03050  Proteasome
mmu05010  Alzheimer disease
mmu05012  Parkinson disease
mmu05016  Huntington disease
mmu05017  Spinocerebellar ataxia
mmu05169  Epstein-Barr virus infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    23997 (Psmd13)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    23997 (Psmd13)
   05012 Parkinson disease
    23997 (Psmd13)
   05016 Huntington disease
    23997 (Psmd13)
   05017 Spinocerebellar ataxia
    23997 (Psmd13)
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    23997 (Psmd13)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:mmu03051]
    23997 (Psmd13)
Proteasome [BR:mmu03051]
 Eukaryotic proteasome
  Regulatory particles
   PA700 (19S proteasome)
    non-ATPase subunits
     23997 (Psmd13)
SSDB
Motif
Pfam: PCI Rpn9_C PARP_reg
Other DBs
NCBI-GeneID: 23997
NCBI-ProteinID: NP_036005
MGI: 1345192
Ensembl: ENSMUSG00000025487
Vega: OTTMUSG00000023443
UniProt: Q9WVJ2 B2RT97
Position
7; 7 F5
AA seq 376 aa
MKDVPAFLQQSQSSGPGQAAVWHRLEELYTKKLWHQLTLEVLDFVQDPCFAQGDGLIKLY
ENFISEFEHRVNPLSLVEIILHVVRQMTDPNVALTFLEKTREKVKSSDEAVILCKTAIGA
LKLNIGDLQATKETIEDVEEMLNNLPGVTSVHSRFYDLSSKYYQTIGNHASYYKDALRFL
GCVDIKDLPVSEQQERAFTLGLAGLLGEGVFNFGELLMHPVLESLRDTDRQWLIDTLYAF
NSGAVDRFQTLKCAWGQQPDLAANEAQLLRKIQLLCLMEMTFTRPANHRQLTFEEIAKSA
KITVNKVELLVMKALSVGLVRGSIDEVDKRVHMTWVQPRVLDLQQIKGMKDRLELWCTDV
KSMEMLVEHQAQDILT
NT seq 1131 nt   +upstreamnt  +downstreamnt
atgaaggatgtgccggccttcttacagcagagtcagagctccgggccgggccaggctgcc
gtttggcaccgtttggaagagctgtacacgaagaagttgtggcatcagctgacacttgag
gtgcttgattttgtgcaggacccatgctttgcccaaggagatggtctcattaagctttat
gaaaacttcatcagtgagtttgagcacagggtaaaccctctgtccctggtagaaataatt
ctccatgtggttagacagatgaccgatcctaatgtggctcttacttttctggaaaagact
cgtgagaaggtaaaaagtagtgatgaagccgtgatcttgtgtaagacggcaatcggagct
ctaaaattaaacatcggcgatctgcaggctacaaaggaaaccattgaagatgttgaagag
atgctcaacaatctccctggtgtgacgtccgttcacagtcgtttctatgatctctccagt
aaatactatcaaacaatcggaaaccacgcgtcctactacaaagatgctctacggtttctg
ggctgtgtggatatcaaggacctgccagtgtcagaacagcaagagagagccttcacactg
gggcttgctggacttctcggagagggagtttttaactttggagaacttctcatgcaccct
gtgctggagtcactgagggacactgaccggcagtggctgattgacaccctgtacgctttc
aatagcggtgctgtggataggttccagacactgaagtgtgcctggggccagcagcctgac
ttagcagccaacgaagcccagcttctgaggaagatccagctgttgtgccttatggagatg
actttcacacggcctgccaaccacagacaactcacttttgaagaaattgccaaaagtgcc
aaaatcactgtcaacaaggtggagttgctggtgatgaaggcactctcggtggggctggtg
agaggcagcatagacgaggtggacaagcgggttcacatgacgtgggtgcagccgcgagtg
ctggatttgcagcagatcaaggggatgaaggaccgtctggagctttggtgcactgatgtg
aagagcatggagatgctggtggaacaccaggctcaggacatcctcacctag

DBGET integrated database retrieval system