KEGG   Mus musculus (mouse): 239985Help
Entry
239985            CDS       T01002                                 

Gene name
Arid1b, 8030481M12, 9330189K18Rik, AI836955, Ardi1b, B230217J03Rik, BAF250B, mKIAA1235
Definition
(RefSeq) AT rich interactive domain 1B (SWI-like)
  KO
K11653  AT-rich interactive domain-containing protein 1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04714  Thermogenesis
mmu05225  Hepatocellular carcinoma
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09159 Environmental adaptation
   04714 Thermogenesis
    239985 (Arid1b)
 09160 Human Diseases
  09162 Cancers: Specific types
   05225 Hepatocellular carcinoma
    239985 (Arid1b)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:mmu03021]
    239985 (Arid1b)
   03036 Chromosome and associated proteins [BR:mmu03036]
    239985 (Arid1b)
Transcription machinery [BR:mmu03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    BAF/PBAF complex
     239985 (Arid1b)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic Type
  Chromatin remodeling factors
   BAF complex
    239985 (Arid1b)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: BAF250_C ARID
Motif
Other DBs
NCBI-GeneID: 239985
NCBI-ProteinID: NP_001078824
MGI: 1926129
Ensembl: ENSMUSG00000069729
Vega: OTTMUSG00000023805
UniProt: E9Q4N7
Position
17; 17 A1
AA seq 2244 aa AA seqDB search
METGLLPNHKLKAVGEAPAAPPHQQHHHHHAHHHHHHHAHHLHHLHHHHALQQQLNQFQQ
PQPPQPQQQQPPPPPQQQHPTANNSLGGAGGGAPQPGPDMEQPQHGGAKDSVAGNQADPQ
GQPLLSKPGDEDDAPPKMGEPAGSRYEHPGLGAQQQPAPVAVPGGGGGPAAVSEFNNYYG
SAAPASGGPGGRAGPCFDQHGGQQSPGMGMMHSASAAAGAPSSMDPLQNSHEGYPNSQYN
HYPGYSRPGAGGGGGGGGGGGGSGGGGGGGGAGGAGGAAAAAAGAGAVAAAAAAAAAAAA
AAGGGGGGGYGSSSSGYGVLSSPRQQGGGMMMGPGGGGAASLSKAAAGAAAAAGGFQRFA
GQNQHPSGATPTLNQLLTSPSPMMRSYGGSYPDYSSSSAPPPPSQPQSQAAAGAAAGGQQ
AAAGMGLGKDLGAQYAAASPAWAAAQQRSHPAMSPGTPGPTMGRSQGSPMDPMVMKRPQL
YGMGTHPHSQPQQSSPYPGGSYGPPGAQRYPLGMQGRAPGALGGLQYPQQQMPPQYGQQA
VSGYCQQGQQPYYNQQPQPSHLPPQAQYLQPAAAQSQQRYQPQQDMSQEGYGTRSQPPLA
PGKSNHEDLNLIQQERPSSLPDLSGSIDDLPTGTEATLSSAVSASGSTSSQGDQSNPAQS
PFSPHASPHLSSIPGGPSPSPVGSPVGSNQSRSGPISPASIPGSQMPPQPPGSQSESSSH
PALSQSPMPQERGFMTGTQRNPQMSQYGPQQTGPSMSPHPSPGGQMHPGISNFQQSNSSG
TYGPQMSQYGPQGNYSRTPTYSGVPSASYSGPGPGMGINANNQMHGQGPAQPCGAMPLGR
MPSAGMQNRPFPGTMSSVTPSSPGMSQQGGPGMGPPMPTVNRKAQEAAAAVMQAAANSAQ
SRQGSFPGMNQSGLVASSSPYSQSMNNNSSLMSTQAQPYSMTPTMVNSSTASMGLADMMS
PSESKLSVPLKADGKEEGVSQPESKSKDSYGSQGISQPPTPGNLPVPSPMSPSSASISSF
HGDESDSISSPGWPKTPSSPKSSSSSTTGEKITKVYELGNEPERKLWVDRYLTFMEERGS
PVSSLPAVGKKPLDLFRLYVCVKEIGGLAQVNKNKKWRELATNLNVGTSSSAASSLKKQY
IQYLFAFECKTERGEEPPPEVFSTGDSKKQPKLQPPSPANSGSLQGPQTPQSTGSNSMAE
VPGDLKPPTPASTPHGQMTPMQSGRSSTVSVHDPFSDVSDSAYPKRNSMTPNAPYQQGMG
MPDMMGRMPYEPNKDPFSGMRKVPGSSEPFMTQGQVPNSGMQDMYNQSPSGAMSNLGMGQ
RQQFPYGTSYDRRHEAYGQQYPGQGPPTGQPPYGGHQPGLYPQQPNYKRHMDGMYGPPAK
RHEGDMYNMQYGSQQQEMYNQYGGSYSGPDRRPIQGQYPYPYNRERMQGPGQMQPHGIPP
QMMGGPMQSSSSEGPQQNMWATRNDMPYPYQSRQGPGGPAQAPPYPGMNRTDDMMVPEQR
INHESQWPSHVSQRQPYMSSSASMQPITRPPQSSYQTPPSLPNHISRAPSPASFQRSLES
RMSPSKSPFLPTMKMQKVMPTVPTSQVTGPPPQPPPIRREITFPPGSVEASQPILKQRRK
ITSKDIVTPEAWRVMMSLKSGLLAESTWALDTINILLYDDSTVATFNLSQLSGFLELLVE
YFRKCLIDIFGILMEYEVGDPSQKALDHRSGKKDDSQSLEDDSGKEDDDAECLVEEEEEE
EEEEEDSEKIESEGKSSPALAAPDASVDPKETPKQASKFDKLPIKIVKKNKLFVVDRSDK
LGRVQEFSSGLLHWQLGGGDTTEHIQTHFESKMEIPPRRRPPPPLSSTGKKKELEGKGDS
EEQPEKSIIATIDDVLSARPGALPEDTNPGPQTDSGKFPFGIQQAKSHRNIRLLEDEPRS
RDETPLCTIAHWQDSLAKRCICVSNIVRSLSFVPGNDAEMSKHPGLVLILGKLILLHHEH
PERKRAPQTYEKEEDEDKGVACSKDEWWWDCLEVLRDNTLVTLANISGQLDLSAYTESIC
LPILDGLLHWMVCPSAEAQDPFPTVGPNSVLSPQRLVLETLCKLSIQDNNVDLILATPPF
SRQEKFYATLVRYVGDRKNPVCREMSMALLSNLAQGDTLAARAIAVQKGSIGNLISFLED
GVTMAQYQQSQHNLMHMQPPPLEPPSVDMMCRAAKALLAMARVDENRSEFLLHEGRLLDI
SISAVLNSLVASVICDVLFQIGQL
NT seq 6735 nt NT seq  +upstreamnt  +downstreamnt
atggagaccgggctgctccccaaccacaaactgaaagccgttggcgaggcccccgctgca
ccgccccatcagcagcaccaccaccaccatgcccaccaccaccaccaccaccatgcccac
cacctccaccacctccaccaccaccacgcactacagcagcagctaaaccagttccagcag
ccgcagccgccgcagccacagcagcagcagccgccgccaccgccgcagcagcagcatccc
actgccaacaacagcctgggcggtgcgggcggcggcgcgcctcagcccggcccggacatg
gagcagccgcaacatggaggcgccaaggacagtgtcgcgggcaatcaggctgacccgcag
ggccagcctctgctgagcaaaccgggcgacgaggacgacgcgccgcccaagatgggggag
ccggcgggcagccgctatgagcacccgggcctgggcgcgcagcagcagcccgcgccggtc
gccgtgcccgggggcggcggcggcccagcggccgtctcggagtttaataattactatggc
agcgctgcccctgctagcggcggccccggcggccgcgctgggccttgctttgatcaacat
ggcggacaacaaagccccgggatggggatgatgcactccgcctctgccgccgccggggcc
cccagcagcatggaccccctgcagaactcccacgaagggtaccccaacagccagtacaac
cattatccgggctacagccggcccggcgcgggcggcggcggcggcggcggcggaggagga
ggaggcagcggaggaggtggaggaggaggaggagcaggaggagcaggaggagcagcggca
gcggcagcaggagccggagctgtggcggcggcggccgcggcggcggcggcagcagcagca
gcagcaggaggaggcggtggcggcggctatgggagctcgtcctcggggtacggggtgctg
agctccccgcggcagcagggcggcggcatgatgatgggccccgggggcggcggggccgcg
agcctcagcaaggcggccgccggcgcggcggcggcggcggggggcttccagcgcttcgcc
ggccagaaccagcacccgtcgggggctacaccgaccctcaaccagctgctcacctcaccc
agccccatgatgaggagctacggcggtagctaccccgactacagcagctccagcgcgccg
ccgccgccgtcgcagccccagtcccaggcggcggcgggggcggcggcgggtggccagcag
gcggccgcgggcatgggcttgggcaaggacctaggcgcccagtacgccgctgccagcccg
gcctgggcggccgcgcaacaaaggagtcacccggcgatgagccccggcacccccggaccg
accatgggcagatcccagggcagcccgatggacccaatggtgatgaagagacctcagttg
tatgggatgggtactcacccccactcccagccacagcagagcagcccatacccaggaggc
tcctacggtcccccaggtgcacagcggtatccccttggcatgcagggccgggctccaggg
gccctgggaggcttgcagtacccgcagcagcagatgccaccgcagtacggacagcaagct
gtgagtggctactgccagcaaggccagcagccatactacaaccagcagccgcagccctcg
cacctcccgccccaggcacagtacctgcagccggcggcggcgcagtcccagcagaggtac
cagccacagcaggacatgtctcaagaaggctatggaactagatctcagcctcctctggcc
cctggaaaatccaaccatgaagacttgaatttaattcaacaggaaagaccatcgagtcta
ccagacctgtctggctccatcgatgacctccccacgggaacagaagcaactctgagctca
gcagtcagtgcatccgggtctacaagcagccagggagatcagagcaacccagcgcagtct
cctttctccccacatgcatcacctcacctctccagcatccctggagggccgtcaccttct
cctgttggctctcctgtgggaagcaaccaatcgaggtctggtccgatctcccctgcgagt
attccaggtagccagatgcctccgcaaccacctggaagccagtcagaatccagttcccat
cctgccttgagccagtcaccaatgccacaggaaagaggttttatgacaggcactcagaga
aaccctcagatgtctcagtacggacctcagcagacaggaccatccatgtcgcctcaccca
tctcctgggggccagatgcatcctgggatcagtaactttcagcagagtaactcaagtggc
acgtacggcccacagatgagccagtatggaccccaaggcaactactccagaaccccaaca
tatagcggggtacccagtgcaagctacagcggcccagggcccggtatgggcatcaatgcc
aacaaccagatgcatggacaagggccagcccagccatgtggtgctatgcccctgggacga
atgccttcagctgggatgcagaacagaccatttcctggaaccatgagcagcgtcaccccc
agttctcctggcatgtctcaacagggagggccaggaatgggcccaccaatgcccactgtg
aaccggaaggcccaggaagctgccgcagctgtgatgcaggctgctgcaaactcagcacaa
agcaggcaaggcagttttcctggcatgaaccagagtggcctggtggcctccagctctccc
tacagccagtccatgaacaacaactccagcctgatgagcacccaggcccagccctacagc
atgacgcccacaatggtgaacagctccacagcatctatgggtcttgcagatatgatgtct
cccagtgagtccaaattgtctgtgcctcttaaagcagatggtaaagaagaaggcgtgtcc
cagcctgagagcaagtcaaaggacagctatggctctcagggcatttcccagcctccaacc
ccaggcaacctgcctgtcccttccccaatgtctcccagctctgccagcatctcctccttt
catggagatgagagtgacagcattagcagcccaggctggcccaagacaccatcaagccct
aagtccagctcttcctccaccactggggagaagatcacgaaggtctatgagctggggaat
gagccggagaggaagctgtgggtcgaccgttacctaacgttcatggaagagaggggctcc
ccggtgtccagtctgccagcagtgggcaagaagcccctggacctgttccgactgtatgtc
tgcgtcaaggagattggaggtttggcgcaggttaataaaaacaagaagtggcgtgagctg
gcaaccaacctgaacgttggcacttccagcagcgcagccagctctctgaaaaagcagtat
attcagtacctgttcgcctttgagtgcaaaactgagcgcggggaggagcccccacctgaa
gtcttcagcaccggggattcgaagaagcagccaaagctccagccgccatctcctgctaac
tcaggatccttacaaggcccacagactccacagtcaactgggagcaattcgatggcagag
gttccaggtgacctgaagccaccaaccccagcctctacccctcatggacagatgactccc
atgcaaagcggaagaagcagtacagtcagtgtgcatgacccgttctcagacgtgagtgac
tcagcgtacccaaaacggaactccatgactccaaacgccccataccagcagggcatgggc
atgccagacatgatgggcaggatgccctatgaacccaacaaggaccctttcagtggaatg
agaaaagtgcctggaagtagtgagccctttatgacacaaggacaggtgcccaacagcggc
atgcaggacatgtacaaccagagcccctcaggggccatgtccaatctgggcatgggacag
cggcagcagtttccctatggaaccagttatgaccgaaggcatgaggcttacggacagcag
tacccaggccaaggccctcccacaggacagccaccgtatggaggacaccagcctggcctg
tacccacagcagccgaattacaaacgtcatatggatggcatgtacgggcctccagccaag
cggcacgagggagacatgtacaacatgcagtatggcagccagcagcaggagatgtataac
cagtatggaggctcctactctggcccggacagaaggcccatccagggacaatatccctac
ccctacaacagagaaaggatgcagggcccaggccagatgcagccacacggaatcccacct
cagatgatggggggccccatgcagtcatcctccagcgaggggcctcagcagaacatgtgg
gctacacgcaacgatatgccttatccctaccagagcaggcaaggcccgggcggccctgca
caggcccccccttacccaggcatgaaccgcacagatgatatgatggtacctgagcagagg
atcaatcacgagagccagtggccttctcacgtcagccagcgccagccttacatgtcatct
tcggcctccatgcagcccatcacgcgcccacctcagtcatcctaccagacgccgccgtca
ctgccaaaccacatctccagggcacccagccccgcctccttccagcgctccctggagagt
cgcatgtctccaagcaagtctcccttcctgcccaccatgaagatgcagaaggtcatgccc
acagtccccacatcccaggtcaccgggccccccccacagcctccaccaatcagaagggag
attacctttcctcctggctccgtagaagcatcacagccaatcctgaaacaaaggcgaaag
attacctcaaaagatattgttactcccgaggcgtggcgtgtgatgatgtcccttaaatcg
ggtctgttggctgagagcacgtgggctctggacaccatcaatattctcctctatgatgac
agcaccgtcgccaccttcaatctttcccagctgtctggattcctggaactattagtagag
tactttcgaaaatgcctaattgacattttcggaattcttatggaatatgaagtgggtgac
cccagccaaaaggctcttgatcaccgttcagggaagaaagatgacagccagtccctggaa
gatgattctgggaaggaagacgatgatgctgagtgtcttgtggaagaggaggaggaggaa
gaggaggaggaggaagacagtgaaaagatagagtcagaggggaagagcagccctgcccta
gctgctccagatgcctccgtggaccccaaggagacgccaaagcaggccagtaagtttgac
aagctgcccataaagattgtcaaaaagaacaagctgtttgtggtggaccggtccgacaag
ctgggccgagtgcaggagttcagcagcgggctcctccactggcagctgggtggtggcgac
actaccgagcacatccagactcacttcgagagcaagatggagatccctcctcgcaggcgt
ccacctccgcctctaagctccacgggtaagaagaaagagctggaaggcaaaggtgattct
gaagagcagccagagaaaagtatcatagccaccatcgatgacgtcttgtctgcccggcca
ggggctctgcctgaagacaccaacccaggaccccagaccgacagcggcaagtttcccttt
ggaatccagcaggccaaaagccaccggaacatcaggctcctggaagacgagcccaggagc
cgagacgagacgccgctgtgcaccatcgcgcactggcaggactcactggccaagcgctgc
atctgtgtgtcgaacatcgtgcggagcttgtctttcgtgcctggcaacgacgcagagatg
tccaaacacccgggcttggtgctgatcctgggaaagctgattctgctgcatcacgagcat
ccggagagaaagcgggcgccacagacctatgagaaggaggaggacgaggacaagggggtg
gcctgcagcaaagatgagtggtggtgggactgcctcgaggtcttgcgggataacaccctg
gtcacgttggcgaacatttccgggcagctagacttgtctgcttacacagagagcatctgc
ttgccgatcctggacggcttgctacactggatggtgtgcccgtccgcagaggctcaggac
ccctttcccactgtggggcccaactcagtcctgtcgccgcagagacttgtgctggagacc
ctgtgtaaactcagtatccaggacaacaacgtggacctgatcttggccacgcctccattt
agtcgtcaggagaaattttatgctacattagttaggtacgttggggatcgcaaaaatcca
gtctgtcgagaaatgtccatggcgcttttatcgaaccttgcccagggggacacactggcg
gcgagggcaatagctgtgcagaaaggaagcattggtaacttgataagcttcctagaggac
ggggtgacgatggcgcagtaccagcagagccagcataaccttatgcacatgcagccccca
cctctggaaccccctagtgtagacatgatgtgccgggcggccaaagctctgctggccatg
gccagagtggacgagaaccgctcggagttccttttgcacgagggtcggttgctggatatc
tcaatatcagctgtcctgaactctctggttgcatctgtcatctgtgatgtactgtttcag
attgggcagttatga

DBGET integrated database retrieval system