KEGG   Mus musculus (house mouse): 24000
Entry
24000             CDS       T01002                                 
Symbol
Ptpn21, PTPD1, PTPRL10
Name
(RefSeq) protein tyrosine phosphatase, non-receptor type 21
  KO
K18025  tyrosine-protein phosphatase non-receptor type 14/21 [EC:3.1.3.48]
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mmu01009]
    24000 (Ptpn21)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.48  protein-tyrosine-phosphatase
     24000 (Ptpn21)
Protein phosphatases and associated proteins [BR:mmu01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Classical)
   Non-receptor PTPs
    24000 (Ptpn21)
SSDB
Motif
Pfam: Y_phosphatase FERM_M FERM_N FERM_C DSPc Y_phosphatase3 PTPlike_phytase
Other DBs
NCBI-GeneID: 24000
NCBI-ProteinID: NP_001139671
MGI: 1344406
Ensembl: ENSMUSG00000021009
UniProt: G5E8J4 Q4KML9
Position
12:complement(98643000..98703664)
AA seq 1176 aa
MPLPFGLKLKRTRRYTVSSKSCLVARIQLLNNEFVEFTLSVESTGQESLEAVAQRLELRE
VTYFSLWYYNKQNQRRWVDLEKPLKKQLDKHALEPTVYFGVLFYVPSVSQLQQEITRYQY
YLQLKKDILEGNLPCTLEHAIQLAGLAVQADFGDFDQYESQDFLQKFALLPVAWLQDEKV
LEEAAQKVALLHQKYRGLTAPEAELLYMQEVERMDGYGEESYPAKDSQGSDISIGACLDG
IFVKHKNGRPPVVFRWHDIANMSHNKSFFALELANKEETIQFQTEDMETAKYVWRLCVAR
HKFYRLNQCSLQTQAATLNSVRRGSSSRMSLPKPQPYAMPPPPQLHYNGHYTEPFASSQD
NIFVPNKNGFYCHSQTSLDRTQIDLSGRIRNGSVYSAHSTNSLNTLQPYLQPSPMSSNPS
ITGSDVMRPDYIPSHRHSALIPPSYRPTPDYETVMKQLNRGMVHADRHSHSLRNLNIGSS
YAYSRPDALVYSQPEIREHPHLTSPQSAHYPFNLNYSFHSQSPYPYPAERRPVVGAVSVP
ELTNVQLQAQDYPAPNIMRTQVYRPPPPYPYPRPANSTPDLSRHLYISSSNPDLITRRVH
HSVQTFQEDSLPVAHSLQEVSEPLTAARHAHLQKRNSIEIAGLTHGFEGLRLKERTVSAS
AADVAPRTFSAGSQSSVFSDKMKQEGTEEQEGGRYSHKKSLSDATMLIHSSEEDEDLEED
SSREQAISAVSEPRLTAAFSQELNYPCASATPITGPLHIFEPKPHVTEPEKRAKDISPVH
LVVETHRPRRDGLLTPSMSESDLTTSGRYRARRDSVKKRPVSDLLSGKKSAVEGLPPLGG
MKKTRADAKKIGPLKLAALNGLSLSRLPLPDEGKEVSTRATNDERCKVLEQRLEQGMVFT
EYERILKKRLVDGECSTARLPENAERNRFQDVLPYDDARVELVPTKENNTGYINASHIKV
SVSGIEWDYIATQGPLQNTCQDFWQMVWEQGVAIIAMVTAEEEGGREKSFRYWPRLGSRH
NTVTYGRFKITTRFRTDSGCYATTGLKMKHLLTGQERTVWHLQYTDWPEHGCPEDLKGFL
SYLEEIQSVRRHTNSTSEPKSHNPPLLVHCSAGVGRTGVVILSEIMVACLEHNEVLDIPR
VLDMLRQQRMMLVQTLGQYTFVYRVLIQFLKSSRLI
NT seq 3531 nt   +upstreamnt  +downstreamnt
atgccactgccatttggattgaaattgaaacgcacccgacgctacactgtgtccagcaag
agctgcctggttgcccggatccagctgctcaataatgagtttgtggagttcactctgtct
gtggagagcactggccaggagagcctagaagctgtggcccagcgcctggagctgagagag
gtcacttactttagcctctggtactacaacaagcagaatcagcggcgctgggtggatttg
gagaaacccctgaagaagcagctggacaagcacgcactggagcctaccgtctacttcggc
gtgctattctatgtgccttctgtttcccagctgcagcaggagattaccaggtatcagtat
tacctgcagctgaagaaagatattctggaaggaaaccttccctgtacattagaacacgcc
attcagctggccggcttagctgttcaagctgattttggtgactttgatcagtatgaatcc
caagattttcttcagaaatttgccttgctccccgtggcatggctacaggatgaaaaagtg
ctggaagaagcagcccagaaagtggccttactgcaccagaaatacagagggctcacagct
cctgaggccgagctgctgtacatgcaggaggtagagagaatggatggctacggagaggag
agctaccctgccaaggacagccaaggaagtgacatatccattggtgcctgtctcgatggc
atctttgtgaaacacaagaacggaaggcctcctgtggtgttcaggtggcacgacattgct
aacatgtcgcataacaagtccttttttgcactagagctggcaaataaagaggagaccatc
cagtttcaaactgaagacatggagacagccaagtacgtgtggcggctgtgtgtggcacgg
cacaaattctacagactgaaccagtgtagcctgcaaacgcaggccgccacgctgaactca
gtcaggaggggctcatcctccaggatgtctctgcctaaaccccagccctatgcgatgcct
cccccaccccagctgcattataatggacattatacagagccatttgcttcttcccaagac
aacatctttgtgcccaacaagaatggattctactgtcactcccagacaagcctggataga
acccagattgacctcagtggtcgcatccgcaacggcagcgtctacagtgcacacagtacg
aattccttaaacacacttcagccctacctgcagccctcccccatgtcctccaacccgagt
atcactggcagtgatgtcatgagacccgactacatcccgtcccaccggcacagtgcgctc
attcccccgtcttaccgcccgacccctgactacgagaccgtgatgaagcagctcaacaga
ggcatggtgcacgcagaccggcacagccactcgctgaggaacctcaacattggcagttcc
tatgcgtacagccggcccgacgccttggtctacagccagcccgagattcgggagcaccct
cacctcacctctccccagtcagcccactacccctttaacctgaactacagtttccacagc
cagtctccgtatccctaccctgccgagaggcggccagtggtgggcgccgtgagtgtgcct
gaactgacaaatgtgcagctgcaggctcaggactacccagctccaaacattatgagaacc
caggtgtaccgcccacccccgccgtatccttacccaagacctgccaacagcaccccagac
ctgtcccgccacctctacatcagcagcagcaatccggatctcatcaccaggcgcgtccat
cactcagtgcagaccttccaggaggacagcttgcccgtggctcactctctgcaggaggtc
agcgagcccctcacagcagcgcgccatgcccacctacagaagaggaacagtattgaaatc
gcagggctcacacatggattcgaaggcctgaggctcaaggagaggacggtgtcagcctca
gcagcagacgtggcgccccggaccttctcagcaggctcccagtccagcgtcttctctgac
aaaatgaagcaggaggggactgaagagcaggagggtggcagatacagccataagaagtcc
ctttctgatgccaccatgctgattcatagcagtgaggaggacgaggacttggaagaggac
agcagcagagaacaggccatctcagctgtgtctgagccccgccttacggccgctttctct
caggaactaaactacccctgtgcttcagcgactccgatcactgggcctctgcatattttt
gagcccaagccccatgtcacagagcctgagaagagggcaaaggacatcagccctgtccac
ctggttgtggagacccatcggccccgaagagatggactgctgaccccctccatgtccgag
tcagacctcacgacctcagggaggtaccgagctaggagggactctgtcaagaaaaggcca
gtgtcagacctcctctctgggaaaaaaagcgctgtggaaggacttccgccactagggggg
atgaaaaaaactcgagcagatgcaaaaaaaattggtcccctcaagctggcagccctcaat
gggctctccctgtcccggctgcccctgcctgatgaaggaaaagaagtgtccaccagagcg
acaaatgacgagaggtgcaaggttctggagcagcggttagagcaaggcatggtcttcacc
gaatatgagaggatccttaagaagcggctggttgatggtgagtgctcgactgcccggctc
cctgaaaatgcagagagaaatcgatttcaagatgtgctcccctacgatgatgcgagagtc
gagttggtgccaaccaaggagaacaacactggctacatcaacgcgtcacacattaaggtc
tctgtcagcggaatagaatgggattatattgccacacagggaccattacaaaatacctgc
caggacttttggcagatggtgtgggaacagggagtcgcaattatagcaatggtgacagca
gaagaggagggaggccgggagaagagctttaggtactggccacggcttggttccaggcac
aacactgtcacctatggaaggtttaagatcacaacgcgcttccgcacggactcgggctgc
tatgccaccacaggtttgaagatgaagcaccttctcacagggcaggagagaaccgtttgg
catcttcagtacacagactggcctgaacacggctgtcccgaagacctcaaaggattttta
tcctaccttgaagagatccagtcagttcgacgtcatacaaacagtaccagtgaacccaaa
agccacaatcccccgctgctggtgcactgcagtgctggcgtgggaagaactggggtcgtc
attctgtcagagatcatggttgcctgtctggaacacaatgaggtgctggacatccccaga
gtgctggacatgctgaggcagcagaggatgatgctggtgcagacacttggccagtacacc
tttgtgtacagagtgctcattcagttcctgaaaagctccaggctcatttaa

DBGET integrated database retrieval system