KEGG   Mus musculus (mouse): 240058
Entry
240058            CDS       T01002                                 

Symbol
Cpne5, A830083G22Rik
Name
(RefSeq) copine V
  KO
K24523  copine 5/8/9
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:mmu04990]
    240058 (Cpne5)
Domain-containing proteins not elsewhere classified [BR:mmu04990]
 Von Willebrand domain-containing proteins
  VWA domain-containing proteins
   240058 (Cpne5)
SSDB
Motif
Pfam: Copine C2 vWA-TerF-like FG-GAP_3
Other DBs
NCBI-GeneID: 240058
NCBI-ProteinID: NP_694806
MGI: 2385908
Ensembl: ENSMUSG00000024008
Vega: OTTMUSG00000028956
UniProt: Q8JZW4
Position
17:complement(29375495..29456764)
AA seq 593 aa
MEQPEDMASLSEFDSLAGSIPATKVEITVSCRNLLDKDMFSKSDPLCVMYTQGMENKQWR
EFGRTEVIDNTLNPDFVRKFIVDYFFEEKQNLRFDLYDVDSKSPDLSKHDFLGQAFCTLG
EIVGSSGSRLEKPLTIGTFSLNSRTGKPMPAVSNGGVPGKKCGTIILSAEELSNCRDVAT
MQFCANKLDKKDFFGKSDPFLVFYRSNEDGTFTICHKTEVMKNTLNPVWQTFSIPVRALC
NGDYDRTIKVEVYDWDRDGSHDFIGEFTTSYRELARGQSQFNIYEVINPKKKMKKKKYVN
SGTVTLLSFAVESESTFLDYIKGGTQINFTVAIDFTASNGNPSQSTSLHYMSPYQLNAYA
LALTAVGEIIQHYDSDKMFPALGFGAKLPPDGRVSHEFPLNGNQENPSCCGIDGILEAYH
SSLRTVQLYGPTNFAPVVTHVARNAAAVQDGSQYSVLLIITDGVISDMAQTKEAIVNAAK
LPMSIIIVGVGQAEFDAMVELDGDDVRISSRGKLAERDIVQFVPFRDYVDRTGNHVLSMA
RLARDVLAEIPDQLVSYMKAQGIRPRPPPAAPAQSPPQSPAHSPPGSPVHTHI
NT seq 1782 nt   +upstreamnt  +downstreamnt
atggagcaacccgaggacatggcgtcgctcagcgagttcgactccttggcgggcagcatc
ccggctaccaaggtggagatcacggtgtcatgcaggaacctcttggacaaagacatgttt
tccaagtctgacccactgtgtgtcatgtacactcaagggatggagaacaagcaatggcga
gagttcggacgcaccgaggtcatagataacacgctcaacccggacttcgtgcgcaagttc
attgtggattacttctttgaggagaagcagaacctccgctttgatctctacgatgttgac
tccaagagcccggatctatctaaacacgacttcctgggccaggccttctgtacccttgga
gaaattgtagggtcctctgggagccgtctggagaagcctctcacgataggaacattcagc
ctcaactcccggacaggcaagcctatgcccgccgtgtctaacggtggtgtcccagggaag
aaatgtggtaccatcatcctgtctgcagaggaactgagcaactgcagggatgtggccaca
atgcagttctgtgccaacaagctggataagaaagatttcttcgggaaatctgaccccttc
ttggtgttctacaggagcaatgaagacggaacgttcaccatctgtcacaagacggaggtc
atgaagaacaccctcaacccggtgtggcaaaccttctccatccccgtgagggctctgtgc
aacggagactatgacaggaccatcaaggtggaggtgtatgactgggatcgtgacggcagc
catgacttcattggggagttcaccaccagctaccgggagctggcacgtggccagagtcag
ttcaacatctatgaggtgataaatccaaaaaagaaaatgaagaaaaagaaatacgtgaat
tctggcacggtcaccctgctttcctttgcggtagagtcagagagtaccttcctggattac
atcaaaggagggacgcagatcaacttcaccgtggccattgacttcactgcctctaatggg
aatccctcacagtccacgtccctccactacatgagtccctaccagctgaacgcctacgcg
ctggcgctgaccgccgtcggagagatcattcagcattatgacagtgacaagatgttccct
gccctgggcttcggggccaagctgccccccgacggcagggtgtcccatgagtttcccctg
aatggcaaccaggagaacccctcctgctgtggcatcgatggcatcctggaggcctaccac
agcagcctgcgcaccgtgcagctttacggccccactaactttgctcctgttgtcactcac
gtagccaggaacgccgcagctgtgcaggatggctcccagtattctgtgctgctcatcatc
actgatggtgtcatctcggacatggcacagaccaaggaggcaattgtaaatgctgccaaa
ctccctatgtcgatcatcattgttggcgtgggccaggccgagttcgatgccatggtggag
ctggacggtgatgacgtgcggatctcctccagggggaagctggctgagcgagacattgtc
cagtttgtgcccttcagggactatgtggaccgcaccggcaaccacgtactgagcatggcc
cgcctggcccgggatgttctggctgagattccggaccaactggtgtcctacatgaaggca
cagggcatccgcccacgcccgccacctgctgcacccgctcagtcacccccacagtcccca
gcccactcacctcctggatcccccgtgcacacgcatatctga

DBGET integrated database retrieval system