KEGG   Mus musculus (mouse): 240067
Entry
240067            CDS       T01002                                 

Gene name
Zfp952, BC057593, C920016K16Rik
Definition
(RefSeq) zinc finger protein 952
  KO
K09228  KRAB domain-containing zinc finger protein
Organism
mmu  Mus musculus (mouse)
Pathway
mmu05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    240067 (Zfp952)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    240067 (Zfp952)
Transcription factors [BR:mmu03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 others
    240067 (Zfp952)
SSDB
Motif
Pfam: zf-H2C2_2 zf-C2H2 zf-C2H2_4 KRAB Zn-ribbon_8 zf-C2H2_jaz Zn_ribbon_SprT zf-C2H2_6 DUF3268 C1_4 zinc_ribbon_15 YhfH
Other DBs
NCBI-GeneID: 240067
NCBI-ProteinID: NP_001039024
MGI: 2441928
Ensembl: ENSMUSG00000053390
Vega: OTTMUSG00000031505
UniProt: B0V2W4
Position
17; 17 B1
AA seq 504 aa
MHQKQRMEPVTFEDVAVNFSLGEWALLDSSQKKLYRDVMTETFMNLISIGKTEEKENIED
NYQNLRKNVRTLVAERSCDYGDVSQCGETRQRIPECIIRRDTPPEISVCKNSVLARDILV
HSLSEVHLRCETAEKPCGSQEYVKCCKESTSSESFQTKQSPPRETPYQNKQSNEAYRSLN
SDRYCEQIHTGDKLREWKQVEKAFWRYSYGQIYERITIGEEPFVCKQYGEALVNSSHLIK
HEVISPEEKCYTCKQCGKAFRYSSSLQNHERIHSGERPYVCKQCGKTFIRSYDLLIHERI
HSGEKPYTCEHCGKSFTHYSGWYSHERIHTREKPYVCTQCGKAFSCSTSFRRHERIHTGE
KPYSCKHCGKAFTHSSARYIHERIHTGEKPYVCKHCGKAFLRASHLNNHERIHTGEKPYI
CKHCGKAFIQRDACYNHERIHTGEKPYVCKECGKAFRISTSLRDHERIHTGEKPYICNYC
GKAFRVSTCLHKHERAHAEKKPSG
NT seq 1515 nt   +upstreamnt  +downstreamnt
atgcatcaaaagcagagaatggagcctgtgacctttgaggatgtggctgtgaacttcagc
ctaggagagtgggctctgctggattccagtcaaaagaagctctacagagatgtgatgacg
gagacctttatgaatctgatctccatagggaaaacagaggaaaaagaaaatattgaagac
aactaccaaaatctcaggaaaaatgtgagaactctggtggctgagaggagttgtgactac
ggagatgtcagtcagtgtggagaaacccggcaacggattccagagtgtatcattcgtaga
gacacgcctcctgaaatatcagtgtgtaaaaacagtgtgcttgctagagacatccttgtt
cattccctctcagaagtgcacctcagatgtgaaactgcagagaaaccctgtgggtctcag
gaatatgtgaagtgttgcaaagagtctacttcttctgagtcctttcagacaaagcaaagt
cctcctcgagagacaccctatcaaaataagcaatctaatgaagcctataggagtcttaat
tctgaccggtattgtgagcaaattcacactggagataaactccgtgaatggaagcaagtt
gagaaagccttctggaggtacagttacggtcaaatatatgagagaatcaccattggagag
gaaccatttgtgtgtaagcagtatggtgaagccttggttaattctagtcatcttattaaa
catgaagtaattagccctgaagaaaaatgttacacatgtaagcagtgtgggaaggcattc
agatattcctcatcccttcagaaccatgaaagaatccatagcggggagaggccatatgta
tgtaagcaatgtggaaaaaccttcattcgttcctatgaccttcttatccatgaaagaatt
cacagtggagaaaaaccttacacgtgtgagcattgtggaaaatctttcacccattatagc
ggctggtacagtcatgaaaggattcacactagagagaaaccctatgtgtgcacacagtgt
gggaaagccttttcatgctctacatcgttccggaggcatgaaagaattcacactggagag
aaaccttactcctgtaagcactgtgggaaagccttcacccattccagtgctcgttacatt
catgagcgaattcacaccggagagaaaccctacgtttgtaagcactgtggaaaagcattc
ctccgtgccagtcatctcaacaaccatgagagaattcacactggagagaaaccctatatt
tgtaagcattgtgggaaagccttcatccagcgcgatgcttgttataatcacgaaagaatt
cacactggagagaaaccatatgtatgtaaggaatgtggaaaagcatttaggatttccaca
tcccttcgtgaccatgagagaattcacactggagaaaaaccttacatatgtaattattgt
gggaaagcatttagggtctccacatgccttcacaaacatgaacgagctcatgctgaaaag
aaacccagtgggtag

DBGET integrated database retrieval system