KEGG   Mus musculus (mouse): 240087Help
Entry
240087            CDS       T01002                                 

Gene name
Mdc1, 6820401C03, AA413496, Nfbd1, mKIAA0170
Definition
(RefSeq) mediator of DNA damage checkpoint 1
  KO
K20780  mediator of DNA damage checkpoint protein 1
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:mmu03400]
    240087 (Mdc1)
DNA repair and recombination proteins [BR:mmu03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    240087 (Mdc1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FHA RTT107_BRCT_5 BRCT Yop-YscD_cpl
Motif
Other DBs
NCBI-GeneID: 240087
NCBI-ProteinID: NP_001010833
MGI: 3525201
Ensembl: ENSMUSG00000061607
Vega: OTTMUSG00000037407
UniProt: Q5PSV9 E9QK89
Structure
PDB: 

Position
17; 17 B1
AA seq 1708 aa AA seqDB search
MESTQVIDWDAEEEEETELSSGSLGYSVEPIGQLRLFSGTHGPERDFPLYLGKNVVGRSP
DCSVALPFPSISKQHAVIEISAWNKAPILQDCGSLNGTQIVKPPRVLPPGVSHRLRDQEL
ILFADFPCQYHRLDVPPPLVPRSLLTIEKTPRIRIESQNSRVLLAADSEEEGDFPSGRCV
ANGQRNTASPSATVVPESDEEVSSPAPSVPGPSSPFGLGSDTDEEQGQQPGVEESSLADS
SGAAGEAEQPEANGTTAGIQAQPTEHKLKDTKVKKEAGRAGVSDGSVLERSPTLGEDSDT
EVDEDHKPGFADSETDVEEERIPVTPPVAPVKKNQVLLAVGIGDPEAPGVAHLQDCLAGS
GTDVEDKTALDVPLERNHTPMVINSDTDEEEEEEEEEVSAALTLAHLKERGIGLWSRDPG
AEEVKSQPQVLVEQSQSASGRDSDTDVEEESSGRKREIIPDSPMDVDEALTVTQPESQPP
RRPNDADEYMDMSSPGSHLVVNQASFAVVGKTRAQVEEEVPGPSVILGEKHQVPLEGAQP
PEEAWETAVQEGSSSPEAAASVRPSQQPVAEDAGTECATAVSEQESTLEVRSQSGSPAAP
VEQVVIHTDTSGDPTLPQREGAQTPTGREREAHVGRTKSAKECCDAEPEDLCLPATQCFV
EGESQHPEAVQSLENEPTQLFPCTLPQEPGPSHLSLQTPGADTLDVPWEVLATQPFCLRE
QSETSELHEAHGSQPSLPREPPGHQHLVHTSPVHTELLRIEGREIQTVEKAMGIPKEMAD
RMTPEREPLEREIRGRTENSERDVIGEELIQGTKDREPKKVLARDSQRKEADKDLEGNRE
SLEVEIEMSKDSQKRERKVEKPEPKREWEPADLEVTPDRGVTEEGSHDQKGQIASLTLKP
GVGVKDLEGLASAPIITGSQADGGKGDPLSPGRQQRGRLSCQTTPAGKASRGDPEPPDHC
LFSSVPEASTQSLLTSQSQKQSTPQPLFSTSSSEIPLPESLHTKPNVRPRRSSRMTPSPH
SSAALKPNTTCPTNQPAASRPTSRPTRGRANRSSTRTPELIVPVDPELQPSTSTEQPVIP
KLTSQVTEGRVQMPEPLLTGPEIQSPTSTEQSVTPDRKPRATRGRPSKSPNKTPEPLIST
GPELQPPTSIEQPVIPKPTSRVTRGRPRKSSVRTPESVVSTGPELQPLTSIEQPVIPEPR
ATRGRPSKSSIKTPESVVPTGPELQPLTSAKQPVTPNLTSRASRGRSSKSIRTPEPVVQT
GPEFHPSTSTEQPDTREPSSQARTRRSAVKTPEASVPTTPELQPFTSKKQPAPKPTALVT
QGRTYKPSTEDCESVGPVAPDFEPSTSTDHLVTPKVTDQSLTLQSSPLSASPVSSTPDLK
PPVPIAQPVTPEPIPQANHQRKRRAAGKQGSRTVPLGHKSYSALSEPEPQSSASQSSGAS
EADSPRQKRPRRQASQKTVVIKEEPVETEVKEEPQETAIPTPEKRKRDHAEEVTQGKPTR
SRRTKPNQETAPKVLFTGVMDSRGERAVLALGGSLASSVNEASHLVTDRIRRTVKFLCAL
GKGIPILSLNWLYQSRKAGCFLPPDDYLVTDPEQEKNFSFSLRDSLCRARERRLLEDYEI
HVTPGVQPPPPQMGEIISCCGGTFLPSMPHSYKLHRVIITCTEDLPRCAIPSRLGLPLLS
PEFLLTGVLKQEATPEAFVLSNLEMSST
NT seq 5127 nt NT seq  +upstreamnt  +downstreamnt
atggaaagcacccaggtgattgactgggatgctgaagaagaggaagagacagaactatcc
agtggctccttggggtatagtgtggagcctatagggcagctacgtctcttcagtggaact
catggaccagaaagagatttccccctctaccttggcaagaatgtagttggtcgaagccct
gactgctctgtggccctgccttttccatccatctccaaacagcatgcagtaattgaaatc
tcagcttggaacaaagcccctatcctccaggattgtgggagcctcaatggcactcaaatc
gtaaagcctcctagggtcctacctcctggagtgagccatcgtctgagggaccaggaatta
attctgtttgcagattttccctgccagtaccatcgcctggatgtcccaccacccttggtc
cctcggagtcttctaactatagagaaaacccccagaatacggatagaatcccaaaattcc
agagttttgttggctgccgattcagaggaagaaggggattttccttctggaaggtgtgtg
gcgaatggacaaaggaatacagcatccccttcagcaacagtagttccagaaagtgatgaa
gaggtctcttctccggccccaagtgtccccgggccatcttcaccctttggtttgggcagt
gacactgatgaagaacaaggtcagcaaccaggagtagaggagtcctctttagctgacagc
agtggtgctgcaggggaagctgagcagcctgaagctaacggaacgacagctggcatacag
gctcagcctactgagcacaaattgaaggacacaaaagtcaagaaggaggcaggcagggca
ggggtctcagatgggtcagttctggagaggagccccactcttggagaggacagtgacaca
gaagtggacgaagatcacaaacctgggtttgcggacagtgagacagatgtggaagaagag
aggatccctgtgaccccccctgtagcccctgtgaagaaaaaccaagtgctacttgcagtt
ggtataggagatcctgaagcacctggtgtggcacatctgcaggactgcctagctggtagt
ggcacagatgtggaggacaagactgcactggatgtccctctagagagaaaccacacaccc
atggtgatcaacagtgatacagatgaggaggaggaggaggaggaggaggaggtctcagca
gcactcactttggcccatctgaaagagagaggaattggtttgtggagtagagacccaggc
gcagaagaggtcaagtcccaaccacaggtccttgtagaacaaagccagagtgcctctggg
agagacagtgacacggatgtggaggaggaatcctcagggcgaaagagagagattatccca
gacagtcccatggatgtagatgaggctcttactgtcacacagccagagagccagcctccc
cgtaggcccaatgatgcagatgagtacatggatatgagctcccctggcagccatctagtg
gtaaatcaggcctcctttgctgtggtaggcaagaccagagcacaagtggaggaggaagtc
ccagggccatctgttatcctgggggagaagcaccaggtgcctctagagggagcccagcct
cctgaggaagcctgggaaacagctgttcaggaaggctcatcctcaccagaggcagcagcc
tctgtaaggcctagccagcagccagtagcagaagatgctgggacagagtgtgctacagct
gtttctgagcaggaaagtactcttgaggtgaggtcccaaagcgggtcacctgcagcacca
gtggagcaagtggtgatacatacagatacttcaggggatcccaccctgccacagagagag
ggagcccaaacccccacaggaagggagagagaagcacatgtgggcaggaccaagagtgcc
aaagagtgctgtgatgcagaacctgaagatctgtgccttccagctacccagtgctttgtg
gaaggggagagccagcacccagaagctgtccagagtttggaaaatgagcctacccaactc
ttcccatgtactcttccacaagagccaggaccttcccatctcagccttcagactccaggt
gcagataccttggatgtgccttgggaagtcttggctacacagccgttctgtctaagagaa
cagtcagagacttctgagcttcatgaagctcatggatctcaaccatctctgcctagggaa
ccaccaggacaccaacatctggttcataccagcccagttcacacagagctgttgagaatt
gaaggcagagagatacagactgtggagaaagccatgggtataccaaaggaaatggcagac
aggatgacccctgagagagagccattggagagggaaatcaggggaagaacagaaaacagt
gagagagatgtgataggagaagaactaattcaggggacaaaggacagagagccaaagaag
gtgttagctagagacagtcagagaaaagaggctgacaaggatcttgaagggaatagggag
agtttggaggtagaaatagagatgtccaaagactcacagaagagagagagaaaagtagag
aaaccagaaccaaagagagaatgggagccagctgatttagaagtgactccagatagaggg
gtgacagaggaagggagccatgatcagaaagggcaaattgctagtctaacactaaagcct
ggagttggggtgaaggaccttgagggacttgcatcagccccaataatcacagggagccag
gcagatggaggaaagggagaccctttgagccctgggaggcagcagagaggccgcttgagt
tgccagacgacacctgctggaaaggcttccaggggtgatccagagcccccagaccactgc
ctgttttcttcagtgcctgaagcttcaactcagagtctcctcacctctcagagccaaaag
cagtctacacctcagcctctgttttcgacctcttcttctgagataccccttcctgagagt
cttcacacaaagcctaatgtcaggccacggcggtcctccaggatgaccccctccccgcat
tcctctgctgcccttaagccaaatactacctgccccacaaaccagcctgctgcctctaga
ccaacatcccgacccactcggggcagggcaaataggtcctctaccaggaccccagaactg
attgtccctgtagaccctgaactccagccttccacctccacagaacagcctgtcatccca
aaacttacgtcccaggtcactgagggcagggtacagatgcctgaaccacttctcacaggt
cccgagatccagtctcccacctccacagaacagtctgtcaccccagaccgcaaacctcgg
gccactcggggcaggccaagtaaatctcccaacaagaccccagaaccacttatttctact
ggccctgaactccaacctcccacctccatagaacaacctgtcatacctaaacccacttct
cgggtcactcggggcagaccacgtaagtcttctgtcaggaccccagaatcagttgtctcc
actggccctgaacttcagcctctcacctctatagaacagcctgttatccctgaacctagg
gccactcgaggtagaccaagtaagtcttctatcaagaccccagaatcagttgtccccact
ggtcctgagctgcagcctcttacctctgcaaaacagcctgtcacccctaacctcacatct
cgggcctctcggggtagatcaagtaagtctatcaggaccccggaaccagttgtccaaact
ggccctgaattccatccatccacctccacagaacagcctgatacccgtgagccctcatct
caggctaggacacgtaggtctgctgtcaagactcctgaagcgagtgtccccacaacccct
gaactccagcctttcacttctaaaaaacagcctgcccctaagcctacagctctggtcact
cagggaaggacatataaaccctccactgaagattgtgaatcagttgggccagtggcccct
gattttgagccttccacctctacagaccatcttgtcacccctaaggttacagatcagagc
ttaacactacagtcttcacccctaagtgcttccccagtttccagtacccctgatctcaag
cctcctgtccccatagcccagcctgttaccccagagcccattccacaagccaatcaccaa
aggaaacgaagggctgctgggaagcagggttcccgcacagtccctctgggtcataagtct
tactctgccctctctgaacctgagccccaatcttcagccagccaaagctcaggagcatca
gaagcagactcaccccgtcaaaaacgtcccagaagacaagcctcccagaaaactgtagtc
atcaaggaagaacctgtagaaacagaagtgaaggaagagcctcaagagactgcaattcca
acaccagaaaagagaaagagggaccatgcagaagaagtgacccagggaaaaccaactcga
agccggcgaactaaacctaaccaagaaacagcccccaaggtactgttcacaggagtcatg
gattctcgtggcgagcgtgcagtgctggctctgggaggcagtctggccagctcagtaaat
gaggcctcccacttagttactgatcgcatccgcaggacagtcaagttcttgtgtgccctg
gggaagggaattcccatcctgtccctgaactggctgtaccagtcccgaaaggctggttgc
ttcttgccgcctgatgactacttagtgactgatcctgagcaagagaagaactttagcttc
agccttcgggattccctgtgccgggctcgggaacgaagactgctggaggactatgagatt
catgtgacccctggcgtgcagccacccccccctcagatgggcgagatcatcagttgctgt
ggaggcactttcctgcccagcatgcctcactcctataagcttcaccgagtcatcataact
tgcactgaagacctaccacgctgtgctattccatcccgcctggggctacccctcctctct
cctgagttcctcctgactggagtgctgaagcaggaagccacaccagaggcctttgttctc
tccaatttggaaatgtcatctacctaa

DBGET integrated database retrieval system