KEGG   Mus musculus (mouse): 240131
Entry
240131            CDS       T01002                                 

Gene name
Lrrc30, Gm326
Definition
(RefSeq) leucine rich repeat containing 30
Organism
mmu  Mus musculus (mouse)
SSDB
Motif
Pfam: LRR_8 LRR_4 LRR_1 LRR_9
Other DBs
NCBI-GeneID: 240131
NCBI-ProteinID: NP_001028512
MGI: 2685172
Ensembl: ENSMUSG00000073375
UniProt: Q3UV48 B2RVX0
Position
17; 17 E1.1
AA seq 300 aa
MGTKQSRASSNDKDPKRLLLGKRQKFSSWDDTLLLGKDPRSLLKRGMRHVSFSLVTKGMT
DIPDFLWGLLEVQKLNLSHNQLRVLPPEVGRLTRIVVLNLCGNCLKSLPREVSLLQSLKV
LFLNMNCLAEVPAELSLCRNLEVLSMSHNCLSQLPASFADLSRLRKLNLSNNYFAHIPLC
VFSLKELDFLHVGSNRLENIAESIQCLASLQIFIAESNNIHSFPRSLCLVTSLELLNLNN
NDIQTLPDELYLLCRLGRIAWNPMDKGLHISHNPLSKPLPELVEGGLEMLYSYLKDKKHN
NT seq 903 nt   +upstreamnt  +downstreamnt
atggggaccaaacagtccagggccagctccaacgacaaggaccccaagaggcttctgttg
gggaagagacagaagttctcgtcgtgggatgataccctgctcttggggaaggacccacgg
tccttgctgaagcgtggcatgcggcacgtcagcttcagtctagtcactaaaggaatgaca
gacatcccagattttctgtggggcttgttggaggtccagaaactcaatctgtcccacaac
cagctccgagttctcccgcctgaggtgggcaggctgacccggatagtggtcctaaacttg
tgtgggaattgcctcaagagtctccccagagaagtcagcctcctccagagcctcaaggtc
ctgttcctcaacatgaactgcctggcggaggtgccggccgagctcagcctgtgcaggaac
ctggaggtgctgagcatgtcgcacaactgcctatcccagctcccagccagctttgcagac
ctctccagacttcggaagctgaaccttagcaacaactactttgctcacatccccctctgt
gtattctctctgaaggagctagactttctgcacgtgggctccaatcgcctagaaaacatc
gctgagagcatccagtgcctggctagcttgcagatcttcattgcagagagcaacaacatc
cactccttccccaggtcgctctgtctcgtcaccagcctagagctgctgaacctgaacaac
aacgacatccagacccttccagatgaactctacctgctctgcagactggggaggattgcg
tggaaccccatggacaaagggctgcacatttcccataatcctttatccaagcccttgccg
gagctggtggaggggggactggagatgctctacagctacctgaaggacaaaaagcacaac
tga

DBGET integrated database retrieval system