KEGG   Mus musculus (mouse): 24015
Entry
24015             CDS       T01002                                 

Gene name
Abce1, C79080, O, Oabp, R, RLI, RNS41, RNS4I, Rnaseli
Definition
(RefSeq) ATP-binding cassette, sub-family E (OABP), member 1
  KO
K06174  ATP-binding cassette, sub-family E, member 1
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:mmu03009]
    24015 (Abce1)
Ribosome biogenesis [BR:mmu03009]
 Eukaryotic type
  Pre-40S particles
   Other pre-40S particles
    24015 (Abce1)
SSDB
Motif
Pfam: ABC_tran RLI SMC_N AAA_21 Fer4 AAA_16 AAA_15 AAA AAA_22 RsgA_GTPase Fer4_7 Fer4_6 AAA_29 NACHT VirE Rad17 AAA_30 SRP54 AAA_33 AAA_24 TsaE Fer4_21 Fer4_2 Fer4_10 AAA_23 Fer4_16 Fer4_9
Other DBs
NCBI-GeneID: 24015
NCBI-ProteinID: NP_056566
MGI: 1195458
Ensembl: ENSMUSG00000058355
Vega: OTTMUSG00000061313
UniProt: P61222 Q3UHY8 Q3TJM9
Position
8; 8 C1
AA seq 599 aa
MADKLTRIAIVNHDKCKPKKCRQECKKSCPVVRMGKLCIEVTPQSKIAWISETLCIGCGI
CIKKCPFGALSIVNLPSNLEKETTHRYCANAFKLHRLPIPRPGEVLGLVGTNGIGKSTAL
KILAGKQKPNLGKYDDPPDWQEILTYFRGSELQNYFTKILEDDLKAIIKPQYVDQIPKAA
KGTVGSILDRKDETKTQAIVCQQLDLTHLKERNVEDLSGGELQRFACAVVCIQKADIFMF
DEPSSYLDVKQRLKAAITIRSLINPDRYIIVVEHDLSVLDYLSDFICCLYGVPSAYGVVT
MPFSVREGINIFLDGYVPTENLRFRDASLVFKVAETANEEEVKKMCMYKYPGMKKKMGEF
ELAIVAGEFTDSEIMVMLGENGTGKTTFIRMLAGRLKPDEGGEVPVLNVSYKPQKISPKS
TGSVRQLLHEKIRDAYTHPQFVTDVMKPLQIENIIDQEVQTLSGGELQRVALALCLGKPA
DVYLIDEPSAYLDSEQRLMAARVVKRFILHAKKTAFVVEHDFIMATYLADRVIVFDGVPS
KNTVANSPQTLLAGMNKFLSQLEITFRRDPNNYRPRINKLNSIKDVEQKKSGNYFFLDD
NT seq 1800 nt   +upstreamnt  +downstreamnt
atggcagacaaattaacaagaattgctattgtcaaccacgacaaatgcaaacctaagaaa
tgtcgacaggagtgcaaaaagagttgccctgtggttcggatgggaaaattgtgcatagaa
gttacaccccagagcaaaatagcatggatttctgaaactctctgtattggttgtggtatt
tgtattaagaaatgtccctttggcgccttatcaattgtcaatttgccaagcaacttggaa
aaagaaacaacacatcgctactgtgccaatgccttcaagcttcacaggttgcctatccct
cgtccaggtgaagttttgggattagttggaactaatggtattggaaagtcaactgcacta
aaaattttagcaggaaaacaaaagccaaaccttggaaagtatgatgatccacctgattgg
caagagattttgacttatttccgtggatctgaattacaaaattactttaccaagattctc
gaagatgacctaaaagccattatcaaacctcaatatgtagaccaaattcccaaggctgca
aaggggacagtgggctctattctggaccgaaaagatgaaacaaagacacaggcaattgta
tgtcagcagcttgatttaactcaccttaaagaacgaaatgtcgaagatctttcaggagga
gagttgcagagatttgcttgtgctgtcgtttgcatacaaaaggctgatatttttatgttt
gatgaaccttctagttacctcgatgtcaagcaacgtttaaaggctgccattacgattcga
tctctaataaatccagatagatatatcattgtggtggagcatgatctaagtgtattagac
tatctctctgacttcatctgctgtctatatggggtaccgagtgcttatggtgttgtcacg
atgccttttagtgtaagagaaggcataaatatatttttggatggctatgttccaacagag
aacctgaggttcagggatgcgtcgcttgtttttaaggtagctgagacagcaaatgaagaa
gaagttaaaaagatgtgcatgtataaatatcccgggatgaagaaaaagatgggagagttc
gagctagcaattgtagctggagagttcacggactctgagatcatggtgatgctgggggag
aatggtacaggtaaaactacatttatcagaatgcttgctggaaggcttaaaccagatgaa
ggaggagaagtgccagttctaaatgtcagttataagccacagaaaatcagtcccaaatca
acaggaagtgttcgccagttactgcatgaaaagatcagagatgcttacacgcatccgcag
tttgtgactgatgtaatgaagcccctacagattgaaaacatcattgaccaagaggtacag
acattgtctggtggtgaacttcagcgagtagctttagctctttgtttgggcaaacctgct
gacgtctatttgattgatgaaccttctgcatatttggattctgagcaaagattaatggca
gctcgggtcgtcaaacgtttcattctccatgcaaagaagacagcttttgttgtagaacat
gacttcatcatggccacctatctagcagatcgcgtcatcgtttttgatggtgttccatca
aagaacacagttgcaaacagtcctcagactcttttggctggcatgaacaaatttttgtct
cagctcgaaattacattcagaagagaccccaacaactacaggccacgaataaataagctc
aattcaatcaaggatgtagaacaaaagaagagtggaaactactttttcttggatgattag

DBGET integrated database retrieval system