KEGG   Mus musculus (mouse): 240255
Entry
240255            CDS       T01002                                 

Gene name
Ythdc2, 3010002F02Rik, BC037178, mYTHDC2
Definition
(RefSeq) YTH domain containing 2
  KO
K20099  ATP-dependent RNA helicase YTHDC2 [EC:3.6.4.13]
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:mmu03041]
    240255 (Ythdc2)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     240255 (Ythdc2)
Spliceosome [BR:mmu03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   RNA helicase-like proteins
    240255 (Ythdc2)
SSDB
Motif
Pfam: YTH HA2 Helicase_C OB_NTP_bind R3H DEAD Ank_2 AAA_19 AAA_22 ATPase PhoH AAA_23 AAA_7 AAA_30 AAA_29 ABC_tran T2SSE SRP54
Other DBs
NCBI-GeneID: 240255
NCBI-ProteinID: NP_001156485
MGI: 2448561
Ensembl: ENSMUSG00000034653
Vega: OTTMUSG00000055570
UniProt: B2RR83
Position
18; 18 B3
AA seq 1445 aa
MSRPSSVSPRPPAPSGGGTGGGGGGSGGGGGGGGGGPASCGPGGGGRAKGLKDIRIDEEV
KIAVNIALERFRYGDQREMEFPSSLTSTERAFIHRLSQSLGLVSKSKGKGANRYLTVKKK
DGSETAHAMMTCNLTHNTKHAVRSLIQRFPVTNKERTELLPKTERGNVFAVEAENREMSK
TSGRLNNGIPQVPVKRGESEFDSFRQSLPVFEKQEEIVKIIKENKVVLIVGETGSGKTTQ
IPQFLLDDCFKNGIPCRIFCTQPRRLAAIAVAERVAAERRERIGQTIGYQIRLESRVSPK
TLLTFCTNGVLLRTLMAGDSTLSTVTHVIVDEVHERDRFSDFLLTKLRDLLQKHPTLKLI
LSSAALDVNLFIRYFGSCPVIYIQGRPFEVKEMFLEDILRTTGYTNKEMLKYKKEKQREE
KQQTTLTEWYSAQENTFKPESQRQRAVASVSEEYDLLDDGGDAVFSQLTEKDVNCLEPWL
IKEMDACLSDIWLHKDVDAFAQVFHLILTENVSVDYRHSETSATALMVAAGRGFTSQVEQ
LISMGANVHSKASNGWMALDWAKHFGQTEIVDLLESYSASLEFGNLDESSLVQTNGNDLS
AEDRELLKAYHHSFDDEKVDLDLIMHLLYNICHSCDAGAILIFLPGYDEIVGLRDRILFD
DKRFADNTHRYQVFMLHSNMQTSDQKKVLKNPPAGVRKIILSTNIAETSITVNDVVFVID
SGKVKEKSFDALNFVTMLKMVWISKASAIQRKGRAGRCRPGICFRLFSRLRFQNMLEFQT
PELLRMPLQELCLHTKLLAPVNCTIADFLMKAPEPPPALIVRNAVQMLKTIDAMDAWEDL
TELGYHLADLPVEPHLGKMVLCAVVLKCLDPILTIACTLAYRDPFVLPTQASQKRAAMLC
RKRFTAGTFSDHMALLRAFQAWQKARSDGWERAFCEKNFLSQATMEIIIGMRTQLLGQLR
ASGFVRARGGGDIRDVNTNSENWAVVKAALVAGMYPNLVHVDRENVILTGPKEKKVRFHP
TSVLSQPQYKKIPPANGQAAAIQALPTDWLIYDEMTRAHRIANIRCCSAVTPVTVLVFCG
PARLASNALQEPSSFRADGIPNDSSDSEMEDRTTANLAALKLDEWLNFKLEPEAASLLLQ
LRQKWHSLFLRRMRAPSKPWSQVDEATIRAIIAVLSTEEQSAGLQQPSGIGQRPRPMSSE
ELPLASSWRSNNSRKSTADTEFADGSTTGERVLMKSPSPALHPPQKYKDRGILHPKRSTD
DRSDQSSVKSTDSSSYPSPCASPSPPSSGKGSKSPSPRPNMPIRYFIMKSSNLRNLEISQ
QKGIWSTTPSNERKLNRAFWESSMVYLVFSVQGSGHFQGFSRMSSEIGREKSQDWGSAGL
GGVFKVEWIRKESLPFQFAHHLLNPWNDNKKVQISRDGQELEPQVGEQLLQLWERLPLGE
KTTSD
NT seq 4338 nt   +upstreamnt  +downstreamnt
atgtccaggccgagcagcgtctcgccgcgtccgccggctcctagcggaggcggcacgggc
ggcggtggaggtggcagtggcggcggcggtggcggtggcggcggcggcccagcttcgtgt
ggtcctggaggcggtggccgggccaagggcctcaaagacattcgtatcgacgaggaggtg
aagatcgccgtcaacatcgctctggagcgcttccgctacggtgaccagagagaaatggaa
ttcccttcttctttgaccagtacggaaagagcctttattcaccgactaagtcaatctctt
ggtttagtttctaaaagtaaaggaaagggagcaaatagatacctaactgtgaagaagaaa
gatggatcagaaacagctcatgcaatgatgacctgtaatttgactcataacacaaaacat
gctgttaggagcctaattcagagatttcctgtcaccaataaagaacgtactgaactccta
cctaaaacagaaagaggaaatgtgtttgcagttgaagctgaaaaccgagaaatgagcaag
acaagcgggcgactcaacaatggcattcctcaagttcctgtgaaaaggggagagtctgaa
tttgactcattcaggcagtctttaccagtttttgagaaacaagaagaaattgttaaaata
attaaggaaaataaagtagttttgatagtaggagaaactgggtctggaaagaccacacag
attcctcagttcctgttagatgattgctttaaaaatggcatcccctgccgaatattttgt
actcaaccaagacgactagcagcgattgctgtggctgaaagagttgctgcagagagaaga
gaaagaattggtcaaacaattggttatcagatccgattagaaagcagggtttcgccaaag
acacttctgacattttgcactaatggggtattgcttcgtacattgatggcaggtgatagc
acattgtcaactgtgacccatgttattgtggatgaagtgcatgaaagggatcgattcagt
gattttttgcttactaagttaagagatttgttgcaaaagcacccaactttgaaactaatt
ctttcgagtgctgccttggatgtgaacctcttcataagatattttggaagttgtccagtg
atatatatacagggaagaccatttgaagtaaaagaaatgtttctggaagatattttaaga
actacaggatataccaacaaagaaatgttaaagtacaaaaaggaaaagcaacgagaggag
aaacaacagaccaccctcacagagtggtactcagctcaagagaataccttcaagcctgag
tctcagaggcagagagctgttgctagtgtgtctgaagagtatgacttattggatgatgga
ggtgatgctgtcttcagtcagctgacagaaaaagatgtgaattgccttgaaccatggtta
atcaaggagatggatgcctgcctttctgacatatggctgcataaagatgttgatgctttt
gctcaggtctttcatcttattttaactgaaaatgttagtgttgattataggcatagtgag
accagtgcaacagctctgatggttgctgcaggacggggctttacgagccaagtagagcag
ttaattagtatgggagccaatgtccacagtaaagcatcaaatggctggatggctttagat
tgggctaagcactttggacagactgaaattgtggatcttctagaatcttacagtgcttca
ttggaatttggaaatctagatgaaagttccttggttcagacaaatgggaatgacctcagt
gcagaagacagagagctgttgaaagcttaccatcatagttttgatgatgagaaagtagac
ttggatttgatcatgcatctcctatataatatctgccatagctgtgatgctggtgcaata
ttaatttttctacctggatatgatgaaattgttggtttgagggatcgtatcctctttgat
gacaagcggtttgctgacaatacacataggtatcaagtctttatgcttcattcaaatatg
cagacatctgatcaaaagaaggtattaaaaaatccacctgcaggtgtccgaaaaataatc
ctttccaccaatattgctgagacgagcatcactgtcaatgatgttgtgtttgttattgat
tctggtaaggtgaaagagaaatcctttgatgcactgaattttgttacaatgttaaaaatg
gtatggatttccaaagctagtgcaatacagcgcaaaggcagagcgggacggtgtagacct
ggaatttgtttccgtctgtttagtagacttcgatttcagaacatgctggaatttcagacg
ccagaactcttgagaatgccattgcaggaactttgtttacataccaagctgttagcccca
gttaactgcaccattgccgacttccttatgaaagcccctgaaccgcctccagctttaatt
gtgagaaatgctgtgcagatgcttaagacaatagatgcaatggatgcatgggaagatctg
actgaacttgggtatcatttggctgatttgccagtagaaccgcatcttgggaaaatggtc
ctgtgtgcagtggttttgaagtgtctggaccccatccttacaattgcctgcacgctcgct
taccgtgacccttttgtcctgcctacccaggcctctcagaaacgggcagctatgctttgt
aggaaacgcttcactgcagggactttcagtgaccacatggcacttctgagagcatttcag
gcatggcagaaagcacgaagtgatgggtgggagcgagccttttgtgaaaagaattttctt
tcacaagctactatggaaatcattataggcatgagaacacagttgcttggtcagcttaga
gcatcaggttttgttagagcacgaggtggtggtgacattcgagatgttaatacaaactcc
gagaactgggctgttgttaaagctgcattggtagcaggcatgtatcctaatttagtccac
gtggacagagagaatgtaatattgacagggccaaaggaaaagaaagtacgctttcatccc
acttcagttctcagtcaacctcaatacaaaaagattcctcccgccaatggtcaggctgca
gcgattcaggcattgcccacagattggcttatttatgatgaaatgaccagagcccatcga
attgctaatatcagatgttgttcagcagtgacacctgttactgtcctggtgttctgtgga
ccagcaagactggcaagtaacgctcttcaggaaccttcatcctttagagcggatggtatt
cccaatgacagcagtgacagtgagatggaagacagaactactgccaatttggctgctttg
aagcttgatgaatggcttaacttcaaactagagccagaggctgccagtttattgctacag
ctcagacagaagtggcatagtttgtttttacgccgaatgagagcgccatctaaaccttgg
tctcaagtcgatgaagctaccatacgagcaattatagctgttttaagcactgaagaacag
tctgcaggtttacagcagccatctggaattggccagcggccaagacccatgtcttcagaa
gaacttcctttggcttcatcttggagatccaataatagtaggaaaagtacagctgacact
gagtttgcggatggatctactactggagaaagagtactgatgaaatctccatctccagcc
ttacatccacctcagaagtacaaagatagaggaattttacatcctaagcggagcaccgat
gaccggtccgatcaatcatctgtgaaatccacagacagcagcagttacccaagtccttgt
gccagcccctctcctccatcctcagggaagggatcaaaatctccttcaccaagaccaaac
atgcctattcgttacttcataatgaagagtagcaatctgagaaaccttgaaatttctcaa
cagaagggtatctggtctacaacccctagtaatgagcggaagctaaatcgagcgttttgg
gagagcagcatggtttacttggtattttctgttcaaggatctggacatttccagggattt
tctaggatgtcttctgagataggaagggagaagagccaggactgggggtcagctggacta
ggtggagtatttaaagtggagtggatacgcaaagaaagccttccctttcagtttgcacac
catttactcaatccttggaacgacaacaagaaagtacagataagcagagatgggcaggag
ctagaacctcaggttggggaacagttgctccagttatgggaacgccttccattgggagaa
aaaacaacttctgattga

DBGET integrated database retrieval system