KEGG   Mus musculus (mouse): 240442Help
Entry
240442            CDS       T01002                                 

Gene name
Adnp2, 8430420L05Rik, BC024969, Kiaa0863, Zfp508, mKIAA0863
Definition
(RefSeq) ADNP homeobox 2
Organism
mmu  Mus musculus (mouse)
SSDB OrthologParalogGFIT
Motif
Pfam: zf-Di19 PRP21_like_P Homeodomain zf-C2H2_3rep Zn-C2H2_12 DUF4674
Motif
Other DBs
NCBI-GeneID: 240442
NCBI-ProteinID: NP_778193
MGI: 2448562
Ensembl: ENSMUSG00000053950
Vega: OTTMUSG00000040169
UniProt: Q8CHC8
Position
18; 18 E3
AA seq 1165 aa AA seqDB search
MFQIPVQNLDNIRKVRKRVKGILVDIGLDSCKELMKDLKSFDPGEKYFYNTSWGDVSPWE
PSGKKARYRTKPYCCSLCRYSTKVLTSLKNHLHRYHEDEADQELMIPCPNCPFSSQPRVV
GKHFRMFHAPARKVQSYTVNILGETKTSRSDVISFTCLKCNFSNTLYYSMKKHVLVAHFN
YLINSYFGLRTEETGEQPKASDPVSVDKILPFDKYYCKKCSAIASSQDALMYHILTSDAH
RDLENKLRSVISEHIKRTGFLKQMHIAPKPVTHLALPPNSSAPSIAAPPPCFQLALPQNS
QSSGTVQSVTVTPGTSGSLTHSPPTTAQSHVALVSSSLPVCQSSLSLQQSAPPPVFLSHS
VALNQPVNTAVLPLTQPVGPVNKSVGTSILPVNQAMCSVNQAVRPGLLPLTKPMGPMNRP
VGPAVLPMGPSVNSGVLQATSPGVISVGRAVPSGVLPAGQVTPAGVIPGQTATSGVLPTG
QVVQSSTLPVGQTAPSRGLPPGQTVPLRVLPAGQVVPSGLLSSNQTVPSGVVPVNQGVNS
GVLQLGQPVTPGVLPVGPPVRPGVLQLSPSVSTSILPMSQPVRAGTSQNTTFFTSGSILR
QLIPTGKQVNGIPTYTLAPVSVTLPVPSGGGLAAVGPPPQVPVQFLPSGSGTQMGSSLPS
LPSPQVLVSPAPSVFVQATPPLADANQALKQAKQWKTCPVCNELFPSNVYQVHMEVAHKQ
SEAQLCQVCNELFPANVYQVHMEVAHKQSESKSSEKLEPEKLAACAPFLKWMREKTVRCL
SCKCLVSQEELMHHLLMHGLGCLFCPCTFHDVRGLVEHSRTKHLGKKRLSMDYSNRGFQL
DLDANGNLLFPHLDFITILPREKLGEREVYLAILAGIHSKSLVPVYVKVRPQPEVAPKIP
NKQKLTCPFCLSTFMTADAYELHLKERHHVMPTVHTMLRSPAFKCIHCCGVYTGNMTLGA
IAVHLLRCRSAPKDSSSDLQVQPGFIESSELLMVNGDVIPESTFPVKRKLPEGHLGPEDQ
RDGEEPQLTLDADASSGSEKGLGAVPLKRQKSEIRTEGSGPSEDSLQALALDPSKYEGRS
YEEKKQFLRDYFHRRPYPSRKEVELLSSLLWVWKIDVASFFGKRRYICMKAIKTHKPSVL
LGFDMSELKNVKHRLNFGECESQKL
NT seq 3498 nt NT seq  +upstreamnt  +downstreamnt
atgtttcaaattcctgtgcagaatcttgacaacatcaggaaggtgcggaagagggtgaaa
ggcatccttgtggatattggccttgacagctgcaaggagctgatgaaggatcttaaaagc
tttgatccaggagagaagtacttttataatacatcgtggggagatgtttctccttgggaa
ccttctggaaagaaagcgagataccggacaaaaccatactgctgtagtctctgtaggtac
tcaacaaaggtgctcacttccctcaaaaatcacctgcatcgatatcatgaagatgaggct
gaccaggagctgatgatcccctgccccaactgcccgttctcctcccagcccagggtggtg
ggcaagcacttcagaatgttccacgcgcctgcacgcaaagtccagagctacacagtgaac
attctgggtgagacgaagacatccaggagtgacgtgataagcttcacgtgtctaaagtgt
aacttttccaacactctgtactacagcatgaagaagcacgtgctggtggcccatttcaat
tacttaattaactcctactttggtttgcgaactgaggaaacaggagagcaaccaaaagca
agcgatcctgtttctgtggataaaatcctgccatttgacaagtactactgtaaaaaatgc
agtgccatcgccagtagtcaggacgccctgatgtatcacattttgacatcagatgcacat
agggacttggagaataagctgaggtctgtgatctcagaacacatcaagaggactgggttt
ctgaagcagatgcatattgctccaaaaccagtgacccacttggctttaccgcccaacagc
agtgctccgagcattgcggcccctccaccctgcttccagcttgctttgccacagaacagt
caaagctctggcactgtgcagtcagtgactgtgaccccaggcacttctgggagccttaca
cactccccacctaccactgcccagtctcacgtagctttggtctccagctctttgcctgtg
tgccagagtagcctcagcctgcagcagtcagctcccccgcctgtctttctctctcacagt
gttgcacttaatcagcctgtgaatactgctgtgctgcccctgactcagccagttgggcct
gtgaataagtctgttggaacaagcatccttcctgtgaaccaagccatgtgctccgtgaac
caagctgtccgccctggacttttacccctcactaagcccatggggcccatgaacagacct
gtggggcctgctgtcttgcctatgggtccctctgttaactcgggggttctccaggctaca
tctcctggagtgatttctgtaggtcgagcagttccatcaggagtccttcctgcaggtcag
gtgacccctgctggagtgatccctggtcagacagccacttctggggtcttacccactggc
caggtggttcagtcatcaactcttcctgttggccagacagctccttctcgaggtcttcct
cctggccagacagtgcccttgagggttctccctgcaggccaggtggtgccatctgggctg
ctttcctcaaaccagactgtcccctcgggagttgtccctgtgaatcagggtgtaaactct
ggcgttcttcagctcggccagccagtaacaccaggagtgcttcctgtgggccccccagtg
aggcctggggtactgcagctcagcccgtctgtcagcaccagcatcctgcctatgagccag
ccggtgagagctggaacgtcacaaaacactactttctttacttcaggctctattctcaga
cagctcattcctactgggaaacaggtgaatggaatccccacgtatacactggcccccgtg
tctgtcactctgccggtgccctctggtggaggccttgcagctgttggaccgccaccccag
gtgccagtgcagttcttgccctcaggctcgggcacacagatgggcagctccttgcccagc
ctgccctctccacaggtgttggtgagccctgcccctagtgtgtttgtgcaggctaccccg
ccgctggcagatgcaaatcaggcactcaaacaggcgaagcagtggaaaacatgcccggtt
tgcaacgagctcttcccttccaatgtctatcaggttcacatggaagtggctcacaagcag
agtgaggctcagctctgccaggtttgcaatgaactctttcctgccaatgtctaccaggtt
cacatggaagtggctcacaagcagagcgagtccaagtctagtgagaaacttgagcctgaa
aagcttgctgcatgtgccccatttctgaagtggatgcgagagaagacagtgcgctgcctg
tcttgtaagtgcctggtctcgcaggaggagctgatgcaccatttgctcatgcatggcctg
ggctgcctgttttgtccgtgcacttttcatgatgtccggggccttgtggagcacagcagg
actaagcacctgggcaagaagagactgtctatggattacagtaacagaggcttccaactg
gacctggatgctaatgggaacctgctcttccctcatctcgatttcatcaccatactgcca
cgagagaaacttggagagcgagaagtgtacctggctatccttgctggaatacactccaag
tcgctggtacctgtgtatgttaaggtgaggcctcagcctgaggttgcaccaaagatacct
aacaaacagaagctgacctgcccattttgtttgagcacatttatgaccgcggatgcctat
gagctacacttgaaggagaggcaccatgtcatgcccacagtccatacaatgctcaggtct
ccggcctttaagtgcatccactgttgcggggtctacactggaaacatgaccttaggcgcc
atcgctgtccatttgctccgttgtagaagtgctcccaaggacagcagctcagacctgcaa
gtccagcccggatttattgagagcagtgaactgctgatggtcaatggggacgtgatccct
gagtccacctttcctgtaaagagaaagctgcctgaaggccatttagggccggaagaccag
agggatggggaggagccccagctcaccctagatgctgatgcaagttcgggttcagagaaa
ggtctgggcgctgtgcctttgaagagacagaagagtgaaatcaggacggaggggtcgggg
cccagtgaagactcactgcaggcgctagccttggaccccagcaagtacgaagggcgttcc
tacgaggaaaagaaacagttccttagagattattttcacaggagaccatatcctagtaga
aaagaagtggagctgctgtcttcactcttgtgggtgtggaaaattgacgtggcttcattc
tttgggaagagaaggtatatttgcatgaaagcaataaaaactcacaagccttctgtactt
ctaggttttgatatgtctgaacttaaaaatgtcaaacacagactgaactttggtgagtgt
gaatcacaaaagctgtag

DBGET integrated database retrieval system