KEGG   Mus musculus (mouse): 24059
Entry
24059             CDS       T01002                                 

Symbol
Slco2a1, 2310021C19Rik, Pg, Pgt, Slc2, Slc21a2, mPg
Name
(RefSeq) solute carrier organic anion transporter family, member 2a1
  KO
K14345  solute carrier organic anion transporter family, member 2A
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mmu02000]
    24059 (Slco2a1)
Transporters [BR:mmu02000]
 Solute carrier family (SLC)
  SLC21/ASLCO: Organic anion transporter
   24059 (Slco2a1)
SSDB
Motif
Pfam: OATP MFS_1 Kazal_2 Kazal_1 TssN
Other DBs
NCBI-GeneID: 24059
NCBI-ProteinID: NP_201571
MGI: 1346021
Ensembl: ENSMUSG00000032548
Vega: OTTMUSG00000048443
UniProt: Q9EPT5 Q3TED0
Position
9 F1; 9 54.72 cM
AA seq 643 aa
MGLLPKPGARQGSGTSSVPARRCSRSVFNNIKVFVLCHGLLQLCQLLYSAYFKSSLTTIE
KRFGLSSSSSGLISSLNEISNAILIIFVSYFGSRVNRPRMIGIGGLLLAAGAFVLTLPHF
LSEPYQYASTTAGNSSHFQTDLCQKHLPGLLPSKCHSTVPDTQKETSSMWSLMVVAQLLA
GVGTVPIQPFGISYVDDFAEPTNSPLYISILFAIAVFGPAFGYLLGSVMLRIFVDYGRVD
TATVNLSPGDPRWIGAWWLGLLISSGFLIVTSLPFFFFPRAMSRGAERSVIAEETMKMEE
DKSRGSLMDFIKRFPRIFLRLLMNPLFMLVVLSQCTFSSVIAGLSTFLNKFLEKQYDASA
AYANLLIGAVNLPAAALGMLFGGILMKRFVFPLQTIPRVAATIMTISIILCAPLFFMGCS
TPAVAEVYPPSTPSSIHPQPPACRRDCLCPDSVFHPVCGDNGVEYLSPCHAGCSSLNVSS
AASKQPIYLNCSCVTGGSASAKTGSCPTSCAQLLLPSIFLISFVALIACVSHNPLYMMVL
RVVNQDEKSFAIGVQFLLMRLLAWLPSPSLYGLLIDSSCIRWNYLCSGRRGACAYYDNDA
LRNRYLGLQVIYKVLGTLLLFFISWRVKKNREYSLQENASGLI
NT seq 1932 nt   +upstreamnt  +downstreamnt
atggggctcctgcccaagcccggagcacgccagggcagcggcacctcctcggtcccagcc
agacgttgctcccgctcggtcttcaacaacattaaggtcttcgtgctttgtcatggcctc
ctacagctctgccagttgctctacagtgcctacttcaagagcagcctcaccactatcgag
aagcgctttgggctctccagttcttcctccggtctcatctccagtttgaatgagatcagc
aacgctatcctcatcatcttcgtcagctacttcggcagccgggtgaaccgcccacggatg
atcggcatagggggtctcctcctggctgcaggggcctttgtcctcaccctcccacacttc
ctgtcagaaccctatcagtacgcgtcgacaactgctggaaacagcagccactttcagacc
gacctctgtcagaagcatttgccaggcctgctccccagtaagtgccacagcaccgtgccc
gatacccagaaggagaccagcagcatgtggagcctgatggtggtcgctcagctgctggcc
ggcgttgggacggtgcccattcagccatttgggatctcctatgtggacgactttgcagag
cctaccaactcgcctctgtatatctccatcttatttgctatcgccgtgtttgggccggct
ttcgggtacctgctgggctcagtcatgctgaggatcttcgtggactacggcagagtggac
acggctacagtgaacctgagcccaggtgaccctcggtggatcggagcctggtggctgggc
ctgctcatctcctcaggcttcttgatcgtcacctctttgccctttttcttctttccccga
gcgatgtccagaggagcagagaggtctgttatcgcagaggagaccatgaagatggaggaa
gacaagtcaagaggctccctgatggatttcattaaacggttcccccgcatcttcctgagg
ctgctgatgaacccactcttcatgctggtggtcctgagccagtgcaccttctcctcagtc
attgctggcctctccacgttcctcaacaagttcctggagaagcagtacgatgcctcggca
gcctatgccaacttactcattggtgctgtgaaccttccagctgcggccttggggatgctg
tttggaggaatcctcatgaagcgttttgttttccctctgcaaaccatcccccgagtagct
gccaccatcatgaccatctccataatcctatgtgcccctctcttctttatgggatgttcc
acacccgccgtggctgaggtctaccctcccagcacaccaagttctatacatccgcagcct
cccgcctgccgcagggactgcctgtgcccagattccgtcttccaccctgtctgcggagac
aatggagtcgagtacctctccccctgccatgctggctgcagcagcctcaacgtgagctca
gcagcttctaagcaaccaatctatttgaactgtagctgtgtgactggaggatccgcatcg
gccaagacaggctcctgccctacatcctgtgcacagctgctgctcccgtccatcttcctc
atctcctttgtggcactcattgcctgcgtctcccacaaccccctctacatgatggtccta
cgtgtggtgaaccaggatgaaaagtcgtttgccattggagtacagttcttgttgatgcgt
ttgctggcctggctgccatctccatccctttatggcctgctcatcgactcctcctgtatc
cggtggaactacctatgctcagggagacgaggggcctgtgcgtattatgacaacgatgct
cttcgaaacaggtacctgggcctacaggtaatctacaaggtcttgggcacactgctgctc
ttcttcatcagctggagggtgaagaagaacagggaatacagtctgcaggagaatgcctcg
ggcctcatctga

DBGET integrated database retrieval system