KEGG   Mus musculus (mouse): 24063Help
Entry
24063             CDS       T01002                                 

Gene name
Spry1, sprouty1, spry-1
Definition
(RefSeq) sprouty RTK signaling antagonist 1
  KO
K04704  protein sprouty homolog 1
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99995 Signaling proteins
    24063 (Spry1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sprouty
Motif
Other DBs
NCBI-GeneID: 24063
NCBI-ProteinID: NP_001292369
MGI: 1345139
Ensembl: ENSMUSG00000037211
Vega: OTTMUSG00000007497
UniProt: Q9QXV9 Q53ZU1
Position
3; 3 B
AA seq 313 aa AA seqDB search
MDSPSQHGSHTSLVVIQPPAVEGRQRLDYDRDTQPATILSLDQIKAIRGSNEYTEGPSVA
RRPAPRTAPRPEKQERTHEIIPANVNSSYEHRPASHPGNARGSVLSRSTSTGSAASSGSS
SSVSSEQGLLGRSPPTRPIPGHRSDRVIRTQPKQLLVEDLKASLKEDPTQHKFICEQCGK
CKCGECTAPRALPSCLACDRQCLCSAESMVEYGTCMCLVKGIFYHCSNDDDGGSYSDNPC
SCSQSHCCSRYLCMGALSLCLPCLLCYPPAKGCLKLCRGCYDWTHRPGCRCRNSNTVYCK
LESCPSRAQGKLS
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atggattccccaagtcagcatggcagccacacttcgctagtggtgattcagccaccggct
gtggaaggccggcagaggttagactatgacagggacactcagcctgctacgattctgtcc
ctagaccagatcaaagccatcagaggcagcaatgaatacacagagggaccttcggtagcg
agaagacctgctcctcgcactgcaccaagacccgaaaagcaggaaaggactcatgaaatc
ataccagccaatgtgaatagcagctacgagcaccgacctgccagccacccgggcaacgcc
aggggctcggtgctgagcaggtccaccagcaccggaagcgcggccagctcagggagcagc
agcagtgtgtcttctgagcagggcctattaggacggtctccgcccaccaggcccatccca
ggtcataggtcagatcgggtcatccggacccagcccaagcagctgctggtggaagacttg
aaggcctccttgaaagaggaccccacccagcacaagttcatctgcgaacagtgtggcaag
tgcaaatgtggagagtgtacggccccccgggccctgccctcctgtctggcctgtgatcgg
cagtgcctctgctccgcggagagcatggtggaatacgggacctgcatgtgcctggtcaag
ggcattttctaccactgctccaatgatgatgatggaggttcttactcggataacccatgc
tcctgttcacagtcccactgctgctccagatacctgtgcatgggagccctgtctttgtgc
ctaccctgcttgctctgctaccctcccgccaagggctgcctgaagctgtgcaggggctgt
tacgactggacccaccgccctggctgcaggtgtagaaactccaacactgtctattgtaag
ctggagagctgcccctcaagggctcagggcaaactgtcatga

DBGET integrated database retrieval system