KEGG   Mus musculus (mouse): 24064Help
Entry
24064             CDS       T01002                                 

Gene name
Spry2, sprouty2
Definition
(RefSeq) sprouty RTK signaling antagonist 2
  KO
K17383  protein sprouty homolog 2
Organism
mmu  Mus musculus (mouse)
Pathway
mmu05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    24064 (Spry2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sprouty CDK2AP
Motif
Other DBs
NCBI-GeneID: 24064
NCBI-ProteinID: NP_036027
MGI: 1345138
Ensembl: ENSMUSG00000022114
UniProt: Q9QXV8 B2RS85
Position
14 E2.3; 14 56.16 cM
AA seq 315 aa AA seqDB search
MEARAQSGNGSQPLLQTAHDSGRQRGEPDPRDALTQQVHVLSLDQIRAIRNTNEYTEGPT
VVPRPGLKPAPRPSTQHKHERLHGLPEHRQPPRLQPSQVHSSRAPLSRSISTVSSGSRSS
TRTSTSSSSSEQRLLGPSFSHGPAAADGIIRVQPKSELKPGDVKPLSKDDLGLHAYRCED
CGKCKCKECTYPRPLPSDWICDKQCLCSAQNVIDYGTCVCCVKGLFYHCSNDDEDNCADN
PCSCSQSHCCTRWSAMGVMSLFLPCLWCYLPAKGCLKLCQGCYDRVNRPGCRCKNSNTVC
CKVPTVPPRNFEKPT
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atggaggccagagctcagagtggcaacgggtcgcagcctttgctgcagacagcccatgac
agtggcaggcagcgcggggagccggatccaagagatgcccttacccagcaggtacacgtc
ttgtctctggatcagatcagagccatccgaaacaccaatgagtacacagagggccctact
gtggtcccaagacctgggctcaagcctgctcctcgcccctccactcagcacaaacatgaa
agactccacggtctgccggagcaccgccagcctcccaggctccagccctcgcaggtccat
tcttcacgggcccctctgtccaggtccatcagcactgtcagctcagggtctcggagcagt
acaaggacaagtaccagcagcagctcctcggaacagagactgttaggaccgtccttctcc
cacgggcctgctgctgctgatggaataatccgagtgcagcctaaatcggagctcaagcct
ggtgacgttaagccactgagcaaggatgatttgggtctgcatgcctacaggtgtgaggac
tgcggcaagtgcaagtgtaaggagtgcacctacccgaggcccctgccgtcggactggatc
tgtgacaagcagtgcctctgctcagcccagaacgtcattgactatgggacttgtgtgtgc
tgtgtgaaaggtctcttctatcactgctccaatgacgatgaggacaattgtgctgacaac
ccgtgctcttgcagccagtcccattgttgtacgcgatggtcagcgatgggagtcatgtct
ctctttttgccttgtttatggtgttaccttccagccaagggttgccttaaattgtgccag
gggtgttatgaccgagtgaacaggccgggttgtcgttgtaaaaactcaaatacagtttgc
tgcaaagttcccactgtcccccctaggaactttgaaaagccgacatag

DBGET integrated database retrieval system