KEGG   Mus musculus (mouse): 240660
Entry
240660            CDS       T01002                                 

Symbol
Slc35g1, AA590464, D330039I19Rik, Tmem20
Name
(RefSeq) solute carrier family 35, member G1
Organism
mmu  Mus musculus (mouse)
SSDB
Motif
Pfam: EamA SLC35F
Other DBs
NCBI-GeneID: 240660
NCBI-ProteinID: NP_780716
MGI: 2444789
Ensembl: ENSMUSG00000044026
UniProt: Q8BY79
Position
19; 19 C3
AA seq 368 aa
MGPPESAAELAAEAVELREPELQLADPASPGEEHVDVEAEGAPGRGRCWPCGAWACGSRG
EPEAKKKAPCPGLGLFYTVLSAFLFSVASLFVKKVQGVHAVEISAFRCVVQMLVIIPCLI
YRKTGFIGPKGQRLFLFLRGVFGSSAMILMYYAFQTTSLADATVIAFSCPVFTSIFAWIF
LKEKYSLWDAFFTLFAIAGVILIVRPPFIFGSDTSGMRESYSEHIKGTFAAIGHAVLAAI
TLVILRKMGKSVDYFLSIWYYVILGLPEAIIILFVIGEWSLPYCGLDRLFLILIGLLGLG
GQIFITKAVQIEKAGLVAIMKTMDIVFAFIFQIAFFDNVPTWWTVGGALCVVVSTTGATI
RRWLQGSK
NT seq 1107 nt   +upstreamnt  +downstreamnt
atggggcccccggagagcgcggcggagcttgcagccgaggcggtggagctgcgcgagccc
gagctgcagctcgcggacccggcgtcccccggcgaggagcacgtggacgtcgaggcggag
ggcgcccctggccgcggcaggtgctggccgtgtggagcctgggcgtgcggctcgcgtggg
gagcccgaagccaagaagaaagcaccctgccccggacttggcttgttttacacggtgttg
tctgccttccttttctcagtggcctctttatttgttaaaaaagtgcaaggcgtccatgct
gtagagatcagtgcgtttcgatgcgtggtccaaatgctagttattatcccttgcttaata
tacagaaaaacggggttcataggtcccaaaggccagcgactcttcctcttcctcagaggg
gtctttggttccagtgccatgatcctcatgtattatgcgttccagacaacgtccctcgca
gacgccacagttattgcgtttagctgtcccgtgtttacgtccatatttgcttggatattt
ctcaaggaaaagtatagcctctgggatgctttcttcaccttgtttgcaatcgctggagtg
atacttatcgtgagaccaccatttatatttggttccgacacttcagggatgagagaaagc
tattcagagcacattaaggggacgtttgctgcgatcggacacgctgtgctagctgcgatc
actctggttattctgaggaaaatgggaaaatctgtggactactttctgagcatctggtac
tatgtcatacttggccttcccgaagccatcatcatcctctttgtcataggagagtggagt
ctgccctactgtgggctggacaggctgtttctcatactcattggactcctaggtttgggg
ggtcagatatttatcactaaagcagttcaaatagaaaaagcaggactcgtagcgataatg
aagaccatggatatagtctttgctttcatctttcagattgctttctttgataatgtacca
acttggtggacggtgggtggggccctctgtgtggtggtcagcaccactggagcaaccatt
cgtcgatggctgcagggttccaaatga

DBGET integrated database retrieval system