KEGG   Mus musculus (mouse): 240697
Entry
240697            CDS       T01002                                 

Gene name
Mcmdc2, 6030422M02Rik
Definition
(RefSeq) minichromosome maintenance domain containing 2
Organism
mmu  Mus musculus (mouse)
Motif
Pfam: MCM_lid MCM Mg_chelatase
Other DBs
NCBI-GeneID: 240697
NCBI-ProteinID: NP_808390
MGI: 3045334
Ensembl: ENSMUSG00000046101
Vega: OTTMUSG00000021854
UniProt: E9Q956
Position
1; 1 A2
AA seq 681 aa
METLQMKEAALVYLDRSGGLQKFIDDCKSYNDSKQSYAVYRFSILIDPCDVVELDADLGN
HILHHPLKAARVFQSVCFVAVKTLSLIGQLQTETQINIVLKLTHLPALPSYTLDLCEFPL
NYASQRFYMMQGIVIAMTTITKYTQGARFLCSDGVCPLSKGFQYVRVHVPGATESATVRN
DFLCSLCSSSLQEDRKFRVLGDKQIVEIITTKMFHAFQGDSKNQPFRFQSLGIFLRDELV
NKMKIGNEYKIIGIPVCVKTSQTALCVEANNITPHTAKVPLGISDNFRRLLSLTSSSCWK
FTAMLANVFASQIVAPGTYNLLKLCLLMSLVQTRDCNREREDCLDILVITSDTLLVDRLL
NFSMNLVSRGIRHPVCTEVFPTVSRNKYGTGAVSIQAGSALLAKGGICFIGDLTSHKKDK
LEQLQSALESRSVTVFIPGKKFGDDFDQQMTFPIQCSFWSFVDMDSSSRRNVQKTSTLIG
QMDCSLIPANLAEAFGLLINCSEASPCHPLLPTVQHTLKKAVEPEGLLYLASKQFTTEDF
EKLLAFAKSLNMEFSLEAERMIHGYYLASRRIRTDSIHGSKLSASALKYLVSLSEAHARL
SLRTTVLREDALIAALLLEISLTLRYGATPFCVAPNALFPFELYNEEYLEQRDLYLTQCQ
QQLQQFIATCGPGTTVFSSDE
NT seq 2046 nt   +upstreamnt  +downstreamnt
atggagactcttcagatgaaagaggcagcccttgtctatcttgacagaagtggaggcctc
caaaagtttatagacgactgcaagtcctacaatgattcaaagcagagttatgctgtctat
cggttcagtattctaatagacccctgtgacgttgttgaattagatgctgaccttggaaat
cacattttacaccatcccttaaaagctgctcgagtttttcaatcagtctgctttgttgct
gttaagactctctcattaattggacagttacagactgaaactcaaatcaatattgtgctg
aagttaacacatttaccagccctgccaagctatactcttgatctttgtgagtttccactt
aattatgcatctcagagattttatatgatgcaaggaattgtgattgcaatgacaactata
accaagtacactcaaggtgcaaggttcttgtgttcagatggagtgtgtcctctttcaaaa
ggatttcagtatgtgagagtccatgtgcctggagctacagaatctgcaacagtaagaaat
gactttttatgcagtctctgttcatcttcacttcaagaagacagaaaatttagagtactt
ggtgataaacagatagttgaaataatcaccacaaaaatgtttcatgcttttcaaggagac
tctaaaaaccagccatttaggtttcaatcacttggtattttcctaagagatgaactagtg
aataagatgaaaataggaaatgaatataaaattattggaattccagtctgtgtcaaaact
tcacaaactgctctctgtgtagaagcaaataatatcactccccacacagcaaaagttcct
ttaggaattagtgacaactttaggcgtctcctctccttgacttcgagctcgtgctggaaa
ttcacagcaatgctggccaatgtctttgcatcacagattgttgctcctgggacttacaat
ttgctcaaactttgtttgttgatgagtctagtacagacaagagactgcaacagggaacga
gaagactgcttggatattttagttataaccagtgacactctgcttgtagacagacttttg
aattttagcatgaatcttgtctcccgtggtatacgtcatcctgtctgtacagaagttttt
cctacagtgtccagaaataaatatggaacaggagcagtgagcattcaggccggcagtgct
ttgcttgctaagggtggtatctgctttataggagacctgacatcccataaaaaagataaa
cttgaacagcttcaatcagctttggagagcagaagcgttacagtattcatcccaggaaag
aagtttggggatgatttcgatcagcaaatgacttttcccattcagtgcagtttttggtct
tttgttgatatggattcatcttcaaggagaaatgtgcagaaaaccagtactctgattggt
cagatggattgcagtttgattccagccaaccttgcagaggcatttggattactgattaac
tgcagtgaggcatctccttgccacccacttcttcctactgtgcagcacactttaaagaaa
gcagtggagcctgaggggctgctgtacttagcgtctaagcagttcacaactgaagacttt
gaaaagctactggcttttgcaaagagtttgaatatggaattcagcttggaagcagaaaga
atgattcatggctattatctagcaagtcgcagaataagaacagattctatacatggatca
aagctgtcagcatctgcattaaaatatttagtgtctttatctgaagcccacgcccggctg
agcctaaggaccacagtgctcagagaagacgcactcatcgcagccttgttgttggaaatc
tctctcacactgagatacggggccactccattttgtgttgctcccaatgcattatttcca
tttgagctgtataatgaagaatatttagagcaaagagatctctacctgactcagtgccaa
cagcagctccaacagtttattgccacatgtggacctgggacaactgtcttttctagtgat
gaataa

DBGET integrated database retrieval system