KEGG   Mus musculus (mouse): 240725
Entry
240725            CDS       T01002                                 

Symbol
Sulf1, AI467640, AW121680, mKIAA1077
Name
(RefSeq) sulfatase 1
  KO
K14607  extracellular sulfatase Sulf [EC:3.1.6.-]
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    240725 (Sulf1)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.6  Sulfuric-ester hydrolases
    3.1.6.-  
     240725 (Sulf1)
SSDB
Motif
Pfam: DUF3740 Sulfatase Phosphodiest
Other DBs
NCBI-GeneID: 240725
NCBI-ProteinID: NP_001185494
MGI: 2138563
Ensembl: ENSMUSG00000016918
Vega: OTTMUSG00000047995
UniProt: Q8K007
Position
1; 1 A3
AA seq 870 aa
MKYSLWALLLAVLGTQLLGSLCSTVRSQRFRGRIQQERKNIRPNIILVLTDDQDVELGSL
QVMNKTRKIMEQGGATFTNAFVTTPMCCPSRSSMLTGKYVHNHNVYTNNENCSSPSWQAM
HEPRTFAVYLNNTGYRTAFFGKYLNEYNGSYIPPGWREWLGLIKNSRFYNYTVCRNGIKE
KHGFDYAKDYFTDLITNESINYFKMSKRMYPHRPIMMVISHAAPHGPEDSAPQFSKLYPN
ASQHITPSYNYAPNMDKHWIMQYTGPMLPIHMEFTNVLQRKRLQTLMSVDDSVERLYNML
VESGELDNTYIIYTADHGYHIGQFGLVKGKSMPYDFDIRVPFFIRGPSIEPGSIVPQIVL
NIDLAPTILDIAGLDSPSDVDGKSVLKLLDLEKPGNRFRTNKKAKIWRDTFLVERGKFLR
KKEESGKNIQQSNHLPKYERVKELCQQARYQTACEQPGQNWQCIEDTSGKLRIHKCKGPS
DLLTVRQNARNLYSRGLHDKDKECHCRDSGYRSSRSQRKNQRQFLRNKGTPKYKPRFVHT
RQTRSLSVEFEGEIYDINLEEEELQVLPPRSIAKRHDEGHQGFIGHQAAAGDIRNEMLAD
SNNAVGLPATVRVTHKCFILPNDTIHCERELYQSARAWKDHKAYIDKEIEVLQDKIKNLR
EVRGHLKKRKPEECGCGDQSYYNKEKGVKRQEKLKSHLHPFKEAAAQEVDSKLQLFKEHR
RRKKERKEKKRQRKGEECSLPGLTCFTHDNNHWQTAPFWNLGSFCACTSSNNNTYWCLRT
VNETHNFLFCEFATGFLEYFDMNTDPYQLTNTVHTVERSILNQLHIQLMELRSCQGYKQC
NPRPKSLDIGAKEGGNYDPHRGQLWDGWEG
NT seq 2613 nt   +upstreamnt  +downstreamnt
atgaagtattccctctgggctctgctgcttgccgtgctgggcacacagctgctgggaagc
ctgtgttccaccgttcggtcccagaggttccgaggaaggatacagcaggaacgaaaaaac
atcagacccaatattatccttgtgctcactgacgaccaggatgtggagctgggttccctg
caagtcatgaacaagacgagaaagatcatggaacagggtggggccaccttcaccaatgcc
tttgtgaccacgcccatgtgctgtccatcacgctcatccatgctcactgggaagtacgtg
cataaccacaatgtctacaccaacaatgagaactgctcgtctccctcgtggcaggcaatg
cacgagcctcggacctttgctgtgtatctcaacaacaccggctacagaacagcctttttt
ggaaaatacctcaatgaatacaatggcagctacatccctcctggatggcgagaatggctc
ggattaatcaagaattctcgtttctataattacactgtttgtcgcaacggcatcaaggag
aagcatggatttgattatgcaaaggattacttcacagacttaatcactaacgagagcatt
aattacttcaaaatgtctaagagaatgtatccccataggcccattatgatggtgatcagc
catgcagcaccacatggccctgaagactccgccccacagttttcaaaactgtaccccaat
gcctcccaacacataacacccagctataactatgcaccgaacatggacaaacactggatc
atgcagtacacagggcccatgttgcctatccacatggagttcaccaacgtcctccagcgc
aaacgactgcagactctgatgtcagttgacgactctgtcgagaggttgtacaacatgctt
gtggagagcggggagctggacaacacttacatcatctacactgcggaccacggctaccac
attggacagtttgggctggtcaaggggaaatccatgccctacgactttgacatccgtgtg
cctttcttcattcgtggtccaagcatagaaccagggtcgatagtcccacagattgttctg
aacatcgacctagctcctaccattctggatattgctggtcttgactctccttctgatgtg
gatggtaaatctgtcctcaaacttctagacctggaaaagccgggtaacaggtttcggaca
aacaagaaggccaaaatctggcgtgatacattcctagtggaaagagggaaatttttacgg
aagaaggaggaatccggcaagaatatccaacagtcaaaccacttgcccaaatatgagagg
gtcaaggaactgtgccagcaagccagataccagacagcctgtgagcagcctgggcagaac
tggcagtgcatcgaggacacatccggcaagctccgaatccacaagtgtaagggacccagc
gacctgctcacggtccgtcagaatgcacgcaacctctactctcgcggattgcatgacaaa
gacaaagagtgccattgtagggactctggctatcgctcgagcagaagccagagaaagaat
caaaggcagttcctgaggaacaagggaacaccaaagtataagcccagatttgtgcacacc
cggcagactcggtccctgtctgttgaattcgaaggtgaaatatatgacatcaacctggaa
gaagaagaactgcaagtgttaccaccaaggagcattgccaagcgccatgatgagggtcac
cagggcttcattggccaccaggctgctgctggtgacatcaggaatgagatgttggcagac
agcaacaatgctgtggggttacccgccactgtccgggtgacacacaagtgctttattctt
ccaaacgacacaatccactgtgagagggagctgtaccagtcagccagagcgtggaaggac
cataaggcctacattgataaagagattgaagttctacaagataaaattaagaatttaagg
gaagtgaggggacacctaaagaaaaggaaacctgaggagtgtggctgtggtgaccagagc
tattacaacaaagagaaaggtgtcaaacgacaggagaagctaaagagtcaccttcacccc
ttcaaggaggctgctgcccaggaggtggatagcaaacttcagctcttcaaggagcatcgg
aggaggaagaaggagaggaaggagaagaaacggcagaggaagggagaggagtgtagcctg
cctggccttacctgcttcacccatgacaacaaccactggcagactgccccattctggaac
ttgggatctttctgtgcctgcacaagttctaacaacaatacctactggtgtttgcgtaca
gtcaacgagacgcacaatttcctgttttgtgagtttgctactggctttctggaatatttc
gacatgaatacggatccttatcagctcacaaatacagtacacacagtagaacggagcatc
ttaaatcagctacacatacagctgatggagctccgaagctgccaagggtataaacagtgc
aacccaagacccaagagcctggacattggagctaaagaaggaggaaactatgacccgcac
agaggacagttatgggatggatgggaaggttag

DBGET integrated database retrieval system