KEGG   Mus musculus (house mouse): 24074
Entry
24074             CDS       T01002                                 
Symbol
Taf7, 55kDa, AI607308, BB007175, TAFII55, Taf2f
Name
(RefSeq) TATA-box binding protein associated factor 7
  KO
K03132  transcription initiation factor TFIID subunit 7
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu03022  Basal transcription factors
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09121 Transcription
   03022 Basal transcription factors
    24074 (Taf7)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:mmu03021]
    24074 (Taf7)
   03036 Chromosome and associated proteins [BR:mmu03036]
    24074 (Taf7)
Transcription machinery [BR:mmu03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIID
     24074 (Taf7)
   Coactivators
    SAGA/TFTC/STAGA complex
     24074 (Taf7)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Histone modification proteins
   HAT complexes
    TFTC complex
     24074 (Taf7)
SSDB
Motif
Pfam: TAFII55_N Tweety
Other DBs
NCBI-GeneID: 24074
NCBI-ProteinID: NP_786964
MGI: 1346348
Ensembl: ENSMUSG00000051316
UniProt: Q9R1C0
Position
18:complement(37773544..37777257)
AA seq 341 aa
MSKNKDDAPHELESQFILRLPPEYAATVRRAVQSGHVNLKDKLSIELHPDGRHGIVRVDR
VPLAAKLVDLPCVTESLKTIDKKTFYKTADISQMLVATVDGDLYPPVEEAAATADPKANK
KKDKDKEKKFVWNHGITLPLKNVRKRRFRKTAKKKYIESPDVEKEVKRLLSTDAEAVSTR
WEIIAEDETKETENQGLDISSPGMSGHRQGHDSLEHDELREIFNDLSSSSEDEEDVNILD
TEEDLERQLQDKLNESDEQHQENEGTNQLVMGIQKQIDNMKGKLQETQDRAKRQEDLIMK
VENLALKNRFQAVLDELKQKEDREKEQLSSLQEELESLLEK
NT seq 1026 nt   +upstreamnt  +downstreamnt
atgagtaagaacaaagacgatgcgcctcatgagctagagagccagtttatcttacgactg
cccccagaatatgccgctacggtgaggagggcagtgcagtctgggcatgtcaacctgaaa
gacaaactgagcattgagttacaccctgatgggcgtcacggcattgtcagagtggatcga
gtgcccttggctgcaaaattggtcgatttgccttgtgttacggaaagcttgaaaaccatc
gataagaaaaccttttacaagacagctgatatctctcagatgcttgtagccacagtagat
ggtgacctataccctcctgtggaggaggcagctgccactgctgatcccaaagcaaacaag
aaaaaagataaggacaaagagaaaaagtttgtttggaaccatggaattactctacctcta
aaaaatgtcagaaagagacggttccggaagacagcaaagaagaagtacattgaatctccg
gatgtggaaaaagaagtcaagcgtctgctgagtacagatgcagaagctgtcagtactcgt
tgggagataattgctgaagatgaaacaaaggagacagaaaatcaaggcctggacatctct
tctccaggaatgtctggccacaggcaaggccatgactcactagagcatgatgagcttcga
gagatattcaatgacctcagcagcagcagtgaagatgaagaagacgtaaacatccttgac
actgaggaagatctggagagacagctacaagacaagctaaatgaatccgacgagcaacac
caagaaaatgaaggaaccaatcagttggttatgggaattcagaagcagatagataacatg
aaaggcaagctccaagaaacccaagacagggcaaagcgccaggaagatctcattatgaag
gtagaaaacctggctctcaagaacaggtttcaggcagttctggatgagctcaaacaaaaa
gaagaccgcgaaaaggagcagcttagctctttgcaggaagagctggaatcacttctggag
aagtga

DBGET integrated database retrieval system