KEGG   Mus musculus (mouse): 240832
Entry
240832            CDS       T01002                                 

Gene name
Tor1aip2, 1110020D10Rik, 15kDa, A130072J07, AA103493, AW060462, AW610675, C77739, Ifrg15, Lull1
Definition
(RefSeq) torsin A interacting protein 2
  KO
K11794  IFRG15 protein
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mmu04121]
    240832 (Tor1aip2)
Ubiquitin system [BR:mmu04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Cul4 complex
    Target recognizing subunit (DCAF)
     240832 (Tor1aip2)
SSDB
Other DBs
NCBI-GeneID: 240832
NCBI-ProteinID: NP_001153652
MGI: 3582695
Ensembl: ENSMUSG00000050565
Vega: OTTMUSG00000021976
UniProt: Q9ER81
Position
1; 1 G3
AA seq 131 aa
MFSDNSHCPDCGQQWFPSLELGHWLYQTELVENECYQVFLDRINRADYCPECYPDNPANR
SLVLPWSFPLEWAPQNLTRWTFEKACHPFLLGPPLVRKKIHDSRVAGFNPALQLILSRTD
KTLNKKLGQSK
NT seq 396 nt   +upstreamnt  +downstreamnt
atgttctccgataattcacactgccctgattgtgggcagcagtggttccctagtttagaa
ctagggcactggttgtaccaaactgaacttgttgaaaatgaatgttaccaagtgttctta
gaccgtattaacagggctgactactgccctgagtgttaccctgacaatcctgctaataga
agccttgttctgccttggtctttcccacttgagtgggcacctcaaaatcttaccaggtgg
acctttgaaaaagcttgccatccatttcttctgggtcctccactggttagaaaaaagata
catgactccagggtagctggctttaatcctgcattacaattaattttgtccagaacagac
aaaaccttaaacaagaaacttggccaaagcaaatga

DBGET integrated database retrieval system