KEGG   Mus musculus (mouse): 240843Help
Entry
240843            CDS       T01002                                 

Gene name
Brinp2, 6430517E21Rik, BB361039, Fam5b, mKIAA1747
Definition
(RefSeq) bone morphogenic protein/retinoic acid inducible neural-specific 2
Organism
mmu  Mus musculus (mouse)
SSDB OrthologParalogGFIT
Motif
Pfam: MACPF
Motif
Other DBs
NCBI-GeneID: 240843
NCBI-ProteinID: NP_997466
MGI: 2443333
Ensembl: ENSMUSG00000004031
Vega: OTTMUSG00000049880
UniProt: Q6DFY8
Position
1; 1 H1
AA seq 783 aa AA seqDB search
MRWPCSSWFRGLWPEAAPWAVLLALGVPGWVLAVSATVAAVVPEQHVSSAGQAPLDWLLT
DRGPFHRAQEYADFMERYRQGFTTRYRIYREFARWKVNNLALERRDFFSLPLPLAPEFVR
NIRLLGRRPNLQQVTENLIKKYGTHFLLSATLGGEESLTIFVDKRKLSRKSETTGGIPVV
GGTGNSSAVSLETLHQLAASYFIDRESTLRRLHHIQIATGAIKVTETRTGPLGCSNYDNL
DSVSSVLVQSPENKVQLLGLQVLLPEHLRERFVAAALSYITCSSEGELVCRENDCWCKCS
PTFPECNCPDADIQAMEDSLLQIQDSWATHNRQFEESEEFQTLLKRLPSDRFLNSTAISQ
YWTMDSNLQHRYQQLGASLKVLLKKMHRIVRRLFNLCKRCHRQPRFRLPKERSLSFWWNR
IQSLLYCGESTFPGTFLEQSHSCTCPYDQSSCQGPIPCALGEGPACAHCASDNSTRCGSC
NPGYVLAQGLCRPEVAESLENFLGLETDLQDLELKYLLQKRDSRIEVHSIFISNDMRLGS
WFDPSWRKRMLLTLKSNKYKPGLVHVMLALSLQICLTKNSTLEPVMAIYVNPFGGSHSES
WFMPVNEGNFPDWERTNVDAAAQCQNWTITLGNRWKTFFETVHVYLRSRIKSLDDSSNET
IYYEPLEMTDPSKNLGYMKINTLQVFGYSLPFDPDAIRDLILQLDYPYTQGSQDSALLQL
IELRDRVNQLSPPGKVRLDLFSCLLRHRLKLANNEVGRIQSSLRAFNSKLPNPVEYETGK
LCS
NT seq 2352 nt NT seq  +upstreamnt  +downstreamnt
atgaggtggccgtgcagctcttggtttagagggctttggccggaggccgccccatgggca
gtcctgctggcgctaggcgtacccgggtgggtgctggctgtctcggccacggtggccgct
gtggtcccggaacagcatgtctcctcagctggccaggctcccctggactggctgctcaca
gaccgaggccccttccaccgagcccaggagtatgctgatttcatggagcgttaccgccag
gggttcaccaccagatacaggatctacagggagtttgcccgatggaaagtgaacaacttg
gccctagaaaggagagatttcttcagtttgcccctgcctctcgccccagagtttgtccgc
aatatccgcctccttggaaggagacccaatctgcaacaggttactgaaaacctcatcaaa
aagtacggcactcatttcttactttctgctactcttggaggagaagagtctctgaccatt
tttgtggacaagaggaaactaagcagaaagtcagaaacaacaggaggtatccctgtagtt
gggggcactgggaacagctccgctgtgtctctggaaaccctgcaccagctggctgcctcc
tacttcattgacagagagagcacactgcgcagacttcaccatatccaaatagccacaggg
gccataaaggtcacagagaccaggactggtccactgggctgcagcaactatgacaacctg
gactcagtcagctctgtcctggttcagagtccagagaacaaggtgcagttactgggcctg
caggtgctgctccctgaacacctgcgtgagcggttcgtggctgcagcactcagctacatc
acatgcagttctgagggcgagctggtctgcagggagaatgactgctggtgcaagtgcagc
cccacattcccggaatgcaactgtcctgatgctgacattcaggctatggaagacagcttg
ctgcagatccaagactcctgggccactcacaacaggcagtttgaagagtccgaagaattc
cagaccctgctgaagaggctccccagtgaccggttcctgaactccacagccatctcccag
tactggaccatggactctaacctccagcaccgttatcagcagctgggagccagcttgaaa
gtcctgttaaagaagatgcaccggatcgtccgccgcctcttcaatctctgcaagcgctgt
catcggcagcctcgcttccgcctgcccaaggagagatccttgtctttctggtggaaccga
atccagtcccttctctactgtggagaaagcaccttccctgggacgttcctggaacagagc
cacagctgcacctgcccctatgaccaatcttcctgccagggccccatcccatgtgccttg
ggggaagggcctgcatgtgctcactgtgcttcagacaattccacgcgctgtgggagttgt
aaccctggttatgtgctagcccagggactgtgtcggccagaggtagctgagtccctggag
aacttccttgggctggagacagacctgcaggaccttgagctgaagtacctgctgcagaag
cgagatagccgcattgaggtacactccatctttatcagcaatgacatgcgcctgggcagc
tggtttgatccttcctggaggaagcggatgctcctgaccttgaagagcaacaagtacaag
cccgggctggtgcatgtgatgttggccttgtccttgcagatctgcctcactaagaacagc
accctggaaccggtcatggccatctacgtgaacccctttgggggcagccactcagagagc
tggttcatgcctgttaatgagggcaacttcccagactgggaaaggactaatgtagacgca
gctgcccagtgccaaaactggactattactttggggaacaggtggaagactttttttgag
acagtccatgtttacctacggagccgaatcaagtccctggatgacagctccaacgagaca
atctactatgagcccctggagatgactgatccctccaagaatttgggctacatgaaaatc
aacaccttgcaggtctttggctacagcctgccctttgacccggatgctatccgagattta
attctccagctggactacccgtatactcaaggttcccaggactctgcactcttacaactc
attgagcttagagaccgggtgaaccaactctctccccctggcaaagtccggctcgacctt
ttctcttgcttgctccggcataggctcaagctggccaacaatgaggtgggcaggatccag
tcctccctgagagcttttaattccaagctgccaaatcctgtggagtatgagacgggcaaa
ctctgtagctaa

DBGET integrated database retrieval system