KEGG   Mus musculus (mouse): 24088
Entry
24088             CDS       T01002                                 

Gene name
Tlr2, Ly10, Ly105
Definition
(RefSeq) toll-like receptor 2
  KO
K10159  toll-like receptor 2
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04145  Phagosome
mmu04151  PI3K-Akt signaling pathway
mmu04613  Neutrophil extracellular trap formation
mmu04620  Toll-like receptor signaling pathway
mmu05132  Salmonella infection
mmu05134  Legionellosis
mmu05140  Leishmaniasis
mmu05142  Chagas disease
mmu05144  Malaria
mmu05145  Toxoplasmosis
mmu05146  Amoebiasis
mmu05152  Tuberculosis
mmu05161  Hepatitis B
mmu05162  Measles
mmu05168  Herpes simplex virus 1 infection
mmu05169  Epstein-Barr virus infection
mmu05170  Human immunodeficiency virus 1 infection
mmu05171  Coronavirus disease - COVID-19
mmu05205  Proteoglycans in cancer
mmu05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
mmu05321  Inflammatory bowel disease
mmu05323  Rheumatoid arthritis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    24088 (Tlr2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    24088 (Tlr2)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    24088 (Tlr2)
   04620 Toll-like receptor signaling pathway
    24088 (Tlr2)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    24088 (Tlr2)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    24088 (Tlr2)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    24088 (Tlr2)
   05161 Hepatitis B
    24088 (Tlr2)
   05171 Coronavirus disease - COVID-19
    24088 (Tlr2)
   05162 Measles
    24088 (Tlr2)
   05168 Herpes simplex virus 1 infection
    24088 (Tlr2)
   05169 Epstein-Barr virus infection
    24088 (Tlr2)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    24088 (Tlr2)
   05134 Legionellosis
    24088 (Tlr2)
   05152 Tuberculosis
    24088 (Tlr2)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    24088 (Tlr2)
   05144 Malaria
    24088 (Tlr2)
   05145 Toxoplasmosis
    24088 (Tlr2)
   05140 Leishmaniasis
    24088 (Tlr2)
   05142 Chagas disease
    24088 (Tlr2)
  09163 Immune disease
   05323 Rheumatoid arthritis
    24088 (Tlr2)
   05321 Inflammatory bowel disease
    24088 (Tlr2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    24088 (Tlr2)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    24088 (Tlr2)
   04054 Pattern recognition receptors [BR:mmu04054]
    24088 (Tlr2)
   04090 CD molecules [BR:mmu04090]
    24088 (Tlr2)
   00536 Glycosaminoglycan binding proteins [BR:mmu00536]
    24088 (Tlr2)
Membrane trafficking [BR:mmu04131]
 Endocytosis
  Phagocytosis
   Toll-like receptors
    24088 (Tlr2)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   24088 (Tlr2)
Pattern recognition receptors [BR:mmu04054]
 Membrane-bound pattern recognition receptors
  Toll-like receptors
   24088 (Tlr2)
CD molecules [BR:mmu04090]
 Proteins
  24088 (Tlr2)
Glycosaminoglycan binding proteins [BR:mmu00536]
 Hyaluronan
  Cell surface receptors
   24088 (Tlr2)
SSDB
Motif
Pfam: LRR_8 LRR_4 TIR TIR_2 LRR_5 LRR_9 LRR_1 LRRCT DUF1863
Other DBs
NCBI-GeneID: 24088
NCBI-ProteinID: NP_036035
MGI: 1346060
Ensembl: ENSMUSG00000027995
Vega: OTTMUSG00000051567
UniProt: Q9QUN7 G3X8Y8
Structure
PDB: 
5D3I

Position
3; 3 E3
AA seq 784 aa
MLRALWLFWILVAITVLFSKRCSAQESLSCDASGVCDGRSRSFTSIPSGLTAAMKSLDLS
FNKITYIGHGDLRACANLQVLMLKSSRINTIEGDAFYSLGSLEHLDLSDNHLSSLSSSWF
GPLSSLKYLNLMGNPYQTLGVTSLFPNLTNLQTLRIGNVETFSEIRRIDFAGLTSLNELE
IKALSLRNYQSQSLKSIRDIHHLTLHLSESAFLLEIFADILSSVRYLELRDTNLARFQFS
PLPVDEVSSPMKKLAFRGSVLTDESFNELLKLLRYILELSEVEFDDCTLNGLGDFNPSES
DVVSELGKVETVTIRRLHIPQFYLFYDLSTVYSLLEKVKRITVENSKVFLVPCSFSQHLK
SLEFLDLSENLMVEEYLKNSACKGAWPSLQTLVLSQNHLRSMQKTGEILLTLKNLTSLDI
SRNTFHPMPDSCQWPEKMRFLNLSSTGIRVVKTCIPQTLEVLDVSNNNLDSFSLFLPRLQ
ELYISRNKLKTLPDASLFPVLLVMKIRENAVSTFSKDQLGSFPKLETLEAGDNHFVCSCE
LLSFTMETPALAQILVDWPDSYLCDSPPRLHGHRLQDARPSVLECHQAALVSGVCCALLL
LILLVGALCHHFHGLWYLRMMWAWLQAKRKPKKAPCRDVCYDAFVSYSEQDSHWVENLMV
QQLENSDPPFKLCLHKRDFVPGKWIIDNIIDSIEKSHKTVFVLSENFVRSEWCKYELDFS
HFRLFDENNDAAILVLLEPIERKAIPQRFCKLRKIMNTKTYLEWPLDEGQQEVFWVNLRT
AIKS
NT seq 2355 nt   +upstreamnt  +downstreamnt
atgctacgagctctttggctcttctggatcttggtggccataacagtcctcttcagcaaa
cgctgttctgctcaggagtctctgtcatgtgatgcttctggggtgtgtgatggccgctcc
aggtctttcacctctattccctccggactcacagcagccatgaaaagccttgacctgtct
ttcaacaagatcacctacattggccatggtgacctccgagcgtgtgcgaacctccaggtt
ctgatgttgaagtccagcagaatcaatacaatagagggagacgccttttattctctgggc
agtcttgaacatttggatttgtctgataatcacctatctagtttatcttcctcctggttc
gggcccctttcctctttgaaatacttaaacttaatgggaaatccttaccagacactgggg
gtaacatcgctttttcccaatctcacaaatttacaaaccctcaggataggaaatgtagag
actttcagtgagataaggagaatagattttgctgggctgacttctctcaatgaacttgaa
attaaggcattaagtctccggaattatcagtcccaaagtctaaagtcgatccgcgacatc
catcacctgactcttcacttaagcgagtctgctttcctgctggagatttttgcagatatt
ctgagttctgtgagatatttagaactaagagatactaacttggccaggttccagttttca
ccactgcccgtagatgaagtcagctcaccgatgaagaagctggcattccgaggctcggtt
ctcactgatgaaagctttaacgagctcctgaagctgttgcgttacatcttggaactgtcg
gaggtagagttcgacgactgtaccctcaatgggctcggcgatttcaacccctcggagtca
gacgtagtgagcgagctgggtaaagtagaaacagtcactatccggaggttgcatatcccc
cagttctatttgttttatgacctgagtactgtctattccctcctggagaaggtgaagcga
atcacagtagagaacagcaaggtcttcctggttccctgctcgttctcccagcatttaaaa
tcattagaattcttagacctcagcgaaaatctgatggttgaagaatatttgaagaactca
gcctgtaagggagcctggccttctctacaaaccttagttttgagccagaatcatttgaga
tcaatgcaaaaaacaggagagattttgctgactctgaaaaacctgacctctcttgacatc
agcaggaacacttttcatccgatgcccgacagctgtcagtggccagaaaagatgcgcttc
ctgaatttgtccagtacagggatccgggtggtaaaaacgtgcattcctcagacgctggag
gtgttggatgttagtaacaacaatcttgactcattttctttgttcttgcctcggctgcaa
gagctctatatttccagaaataagctgaaaacactcccagatgcttcgttgttccctgtg
ttgctggtcatgaaaatcagagagaatgcagtaagtactttctctaaagaccaacttggt
tcttttcccaaactggagactctggaagcaggcgacaaccactttgtttgctcctgcgaa
ctcctatcctttactatggagacgccagctctggctcaaatcctggttgactggccagac
agctacctgtgtgactctccgcctcgcctgcacggccacaggcttcaggatgcccggccc
tccgtcttggaatgtcaccaggctgcactggtgtctggagtctgctgtgcccttctcctg
ttgatcttgctcgtaggtgccctgtgccaccatttccacggactgtggtacctgagaatg
atgtgggcgtggctccaggccaagaggaagcccaagaaagctccctgcagggacgtttgc
tatgatgcctttgtttcctacagtgagcaggattcccattgggtggagaacctcatggtc
cagcagctggagaactctgacccgccctttaagctgtgtctccacaagcgggacttcgtt
ccgggcaaatggatcattgacaacatcatcgattccatcgaaaagagccacaaaactgtg
ttcgtgctttctgagaacttcgtacggagcgagtggtgcaagtacgaactggacttctcc
cacttcaggctctttgacgagaacaacgacgcggccatccttgttttgctggagcccatt
gagaggaaagccattccccagcgcttctgcaaactgcgcaagataatgaacaccaagacc
tacctggagtggcccttggatgaaggccagcaggaagtgttttgggtaaatctgagaact
gcaataaagtcctag

DBGET integrated database retrieval system