KEGG   Mus musculus (mouse): 240913
Entry
240913            CDS       T01002                                 

Symbol
Adamts4, ADAM-TS4, ADAMTS-2, ADMP-1
Name
(RefSeq) a disintegrin-like and metallopeptidase (reprolysin type) with thrombospondin type 1 motif, 4
  KO
K07764  a disintegrin and metalloproteinase with thrombospondin motifs 4 [EC:3.4.24.82]
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mmu01002]
    240913 (Adamts4)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.82  ADAMTS-4 endopeptidase
     240913 (Adamts4)
Peptidases and inhibitors [BR:mmu01002]
 Metallo peptidases
  Family M12: astacin/adamalysin family
   240913 (Adamts4)
SSDB
Motif
Pfam: ADAMTS_spacer1 ADAMTS_CR_2 Reprolysin Reprolysin_5 TSP_1 Reprolysin_3 ADAMTS_CR_3 Pep_M12B_propep TSP1_spondin Reprolysin_2 Reprolysin_4 TSP1_ADAMTS Peptidase_M7
Other DBs
NCBI-GeneID: 240913
NCBI-ProteinID: NP_766433
MGI: 1339949
Ensembl: ENSMUSG00000006403
Vega: OTTMUSG00000021528
UniProt: Q8BNJ2
Position
1:171077698..171089836
AA seq 833 aa
MSQMGLHPRRGLTGHWLQRFQPCLPLHTVQWRRLLLLAFLLSLAWPASPLPREEEIVFPE
KLNGSSILPGSGVPARLLYRLPAFGEMLLLELEQDPGVQVEGLTVQYLGQAPEMLGGAEP
GTYLTGTINGDPESVASLHWDGGALLGVLQYRGAELHLQPLEGGALNSAGGPGAHILRRK
SPASSQGPMCTVKAPSGSPSPISRRTKRFASLSRFVETLVVADDKMAAFHGTGLKRYLLT
VMAAAAKAFKHPSIRNPVNLVVTRLVILGSGQEGPQVGPSAAQTLRSFCTWQRGLNTPND
SDPDHFDTAILFTRQDLCGVSTCDTLGMADVGTVCDPARSCAIVEDDGLQSAFTAAHELG
HVFNMLHDNSKPCTNLNGQGGSSRHVMAPVMAHVDPEEPWSPCSARFITDFLDNGYGHCL
LDKPEAPLHLPATFPGKDYDADRQCQLTFGPDSSHCPQLPPPCAALWCSGHLNGHAMCQT
KHSPWADGTPCGSSQACMGGRCLHVDQLKDFNVPQAGGWGPWGPWGDCSRTCGGGVQFSS
RDCTRPVPRNGGKYCEGRRTRFRSCNTENCPHGSALTFREEQCAAYNHRTDLFKSFPGPM
DWVPRYTGVAPRDQCKLTCQARALGYYYVLEPRVADGTPCSPDTSSVCVQGRCIHAGCDR
IIGSKKKFDKCMVCGGDGSRCSKQSGSFKKFRYGYSDVVTIPAGATHILVRQQGGSGLKS
IYLALKLSDGSYALNGEYTLMPSPTDVVLPGAVSLRYSGATAASETLSGHGPLAQPLTLQ
VLVAGNPQNARLRYSFFVPRPVPSTPRPPPQDWLQRRAEILKILRKRPWAGRK
NT seq 2502 nt   +upstreamnt  +downstreamnt
atgtcccagatgggcttgcatcccaggaggggcttgactgggcactggctgcaaagattc
caaccctgcttgccgcttcacactgtgcagtggcggaggctgctgctgctggccttcctc
ctgtccttagcgtggcccgccagccccctcccccgggaggaggagatcgtgtttccagag
aagctcaatggcagtagcatcctacctggatcaggcgttcctgccaggctgctgtaccga
ttgccagcctttggggagatgttgctactagaactagaacaggaccctggggtgcaggta
gagggtttgactgtacagtacctgggccaggcacctgagatgctgggtggggcagagcca
ggtacctacctgactggcaccatcaatggagatccggagtcggtggcatctctgcactgg
gacgggggagccctattaggggtactgcagtaccgtggggccgaactccacctccagcct
ctggaaggaggcgcccttaactctgctgggggaccgggggctcacatcctacgccggaag
agtcctgccagcagccaaggtcccatgtgcaccgtcaaggctccttctgggagcccgagt
cccatttcccgcagaaccaagcgcttcgcttctctgagtagattcgtggagacactggtg
gtagcagatgacaagatggcagcattccatggtacagggttaaagcgctacctgctgacg
gttatggcagctgccgctaaagcctttaaacacccaagcatccgaaaccctgtcaacttg
gtggtgacgcgcctggtgatcctggggtccggccaggaagggccccaagtggggccaagt
gccgcccagaccctacgcagcttctgcacctggcagcggggcctcaacacccctaacgac
tcagatcctgaccactttgacacagccattctgttcacccggcaggacctgtgtggggtc
tccacttgtgacaccctgggtatggctgatgtgggcacagtgtgtgatccagctaggagc
tgtgctattgtggaagatgatgggctccagtcagccttcactgctgctcatgaactgggc
catgtcttcaacatgctccatgataactccaagccatgcactaacttgaatgggcagggg
ggttcctctcgccatgtcatggctcctgtcatggcccatgtggaccctgaagagccctgg
tcgccctgcagtgcccgattcatcactgacttcctggacaatggttatgggcactgcctc
ttagacaaaccggaggctcccctccatctaccagcgacttttcctggcaaggactatgac
gctgaccgccaatgccaactgaccttcggtcctgactcaagccattgtccacagctgcca
ccgccctgtgctgccctctggtgctctggccacctcaatggccatgccatgtgccagacg
aagcactcaccttgggctgatggcactccctgcgggtcttcacaggcctgcatgggtggc
cgctgtctgcacgtggaccagctcaaggacttcaatgttcctcaggctggaggctggggc
ccctggggaccatggggtgactgctccaggacttgtgggggtggtgtccagttctcctcc
cgggattgcacgaggcccgtcccccggaacggtggcaagtattgtgagggccgccggact
cgcttccgctcctgcaacacggagaactgcccacacggctcagcattgaccttccgtgaa
gagcagtgtgctgcctacaaccaccgaaccgacctcttcaagagctttccagggcccatg
gactgggttccgcgctacacaggtgtggcccctcgagaccaatgcaaactcacctgccag
gcccgggcactgggctactactacgtattggagccccgggtggcagatgggactccctgc
tccccagacacctcctctgtctgtgtccagggccgctgtatccatgctggctgtgaccgg
atcattggctccaaaaagaaatttgacaagtgcatggtgtgcggcggggatggctctcgc
tgcagcaagcagtcgggctccttcaaaaaattcaggtatggatacagcgatgtggtcacg
atccctgcgggggccacccatatccttgtacggcagcagggggggtctggtctcaagagc
atctacctggccctgaagctttctgacggttcttacgccctcaatggtgaatacacgctg
atgccctccccaacagatgtggttcttcctggggcagtcagcttgcgctacagcggagcc
acagcagcctcagagacactgtctggacatgggccgctggcccagcccttgacgctgcaa
gtcctggtggctggcaacccacagaatgcacgtctgcggtacagtttctttgtcccgcgg
ccagtcccttcaacaccacgccctcctccccaagactggctgcaacgcagggcagagata
ctgaagatccttcggaagcgtccctgggcaggccggaaataa

DBGET integrated database retrieval system