KEGG   Mus musculus (mouse): 24110
Entry
24110             CDS       T01002                                 

Gene name
Usp18, 1110058H21Rik, AW047653, UBP4, UBP43, Ubp15
Definition
(RefSeq) ubiquitin specific peptidase 18
  KO
K11846  ubiquitin carboxyl-terminal hydrolase 18/41 [EC:3.4.19.12]
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mmu01002]
    24110 (Usp18)
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mmu04121]
    24110 (Usp18)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     24110 (Usp18)
Peptidases and inhibitors [BR:mmu01002]
 Cysteine peptidases
  Family C19: ubiquitin-specific protease family
   24110 (Usp18)
Ubiquitin system [BR:mmu04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   UBP/USP
    24110 (Usp18)
SSDB
Motif
Pfam: UCH UCH_1
Other DBs
NCBI-GeneID: 24110
NCBI-ProteinID: NP_036039
MGI: 1344364
Ensembl: ENSMUSG00000030107
Vega: OTTMUSG00000056866
UniProt: Q9WTV6 Q3UAR6
Structure
PDB: 
5CHT 5CHV

Position
6 F1; 6 57.17 cM
AA seq 368 aa
MGKGFGLLRKPCQSVVAEPQQYSALEEERTMKRKRVLSRDLCSAWDSPHGLVGLHNIGQT
CCLNSLLQVFMMNMDFRMILKRITVPRSAEERKRSVPFQLLLLLEKMQDSRQKAVLPTEL
VQCLQKYNVPLFVQHDAAQLYLTIWNLTKDQITDTDLTERLQGLFTIWTQESLICVGCTA
ESSRRSKLLTLSLPLFDKDAKPLKTLEDALRCFVQPKELASSDMCCESCGEKTPWKQVLK
LTHLPQTLTIHLMRFSARNSRTEKICHSVNFPQSLDFSQVLPTEEDLGDTKEQSEIHYEL
FAVIAHVGMADFGHYCAYIRNPVDGKWFCFNDSHVCWVTWKDVQCTYGNHRYRWRETAYL
LVYTKTGS
NT seq 1107 nt   +upstreamnt  +downstreamnt
atgggcaaggggtttgggctcctgaggaaaccctgccagtcagttgtggctgagccgcag
cagtactcagcgctggaggaagagaggaccatgaagaggaagagagtgctgtctagagac
ctctgcagtgcctgggacagccctcatggtctggttggtttacacaacatcggacagacg
tgttgccttaactccttgcttcaagtgttcatgatgaacatggacttcagaatgatattg
aagaggataacagtgcctcggagtgcagaagagaggaagagaagtgtccccttccagctg
cttttgctgctggagaagatgcaggacagtcgacagaaagccgtgctgcccacggagctc
gttcagtgcctgcagaaatacaacgtgccgttgtttgtccagcacgatgctgctcaactc
taccttacaatctggaacctgactaaggaccagatcacggacacagacttgacagagcgg
ctgcagggtctgttcaccatctggacgcaggagtccctgatttgcgtgggctgtacagca
gagagcagcaggaggagcaaactgctcacactctctcttcctctttttgataaggacgca
aagcctctgaaaaccctggaggatgccttgagatgtttcgtccagcccaaagagttagca
agctccgacatgtgctgcgagagctgtggggagaagacgccttggaaacaggttctgaag
ctgactcatctgccccaaaccttgaccattcacctcatgagattctctgccaggaactcg
aggacggaaaagatctgtcactcagttaatttccctcagagcttggatttcagtcaggtt
ctgccaaccgaggaagacctcggtgataccaaggaacagtctgaaatacactatgaactc
tttgccgtgattgcccacgttgggatggctgactttggtcattactgtgcctacatccgg
aatcccgtggatggaaagtggttctgcttcaatgactcacatgtttgttgggtcacctgg
aaggatgtccagtgtacctatgggaaccacagataccgctggcgggaaacggcctatctc
ttggtttacacgaagactggatcctga

DBGET integrated database retrieval system