KEGG   Mus musculus (house mouse): 241116
Entry
241116            CDS       T01002                                 
Symbol
Cfap65, A230051F10, B230363K08Rik, Ccdc108
Name
(RefSeq) cilia and flagella associated protein 65
  KO
K24226  cilia- and flagella-associated protein 65
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   03037 Cilium and associated proteins [BR:mmu03037]
    241116 (Cfap65)
Cilium and associated proteins [BR:mmu03037]
 Motile cilia and associated proteins
  Sperm associated proteins
   241116 (Cfap65)
SSDB
Motif
Pfam: ASH PapD-like TMEM131_like_N Nop14
Other DBs
NCBI-GeneID: 241116
NCBI-ProteinID: NP_001034584
MGI: 2444274
Ensembl: ENSMUSG00000047021
UniProt: Q3V0B4
Position
1:complement(74941230..74974785)
AA seq 1847 aa
MLIQKNQCHITRTRENCDCTMNTVNEDLCLSASTLGSSSVTTQLVDPLDRKICLIRRQND
VKKRVIWGIEVAEKLHWKGWELGKETTRTLVLKNLSLKTQKMKYRPPKTKFFFTIIPQPI
FLSPGITLTLPIVFRPLEAKEYTDQLWFEKEEGVFCVTLKATLPCYKLDCPSSLQLPMCA
LGDTVETWFCLNNVGDLPTFFTWEVPAPFQILPTTGLLEPGLGCKIKVTFEPLIAVIHEV
EALCWYGKGNKQKNSINIQAAAKCAQLLVSIKHKGLEDQDQEGFQKVVHFGYVSVGSVAE
RQIRLYNPSAVNAPFKIEMAEHVLTKDPSFSCSTSQGIVPPGEKKCLSLFFHPKTLDSRA
IDYFSIIPSGCATKTLLQVVGFCRGPDAVLQHSCVNFHWVKLGERREQTLWIENQSDCQA
HFQFDIDCQESVFSIRPAFGTLAGKTRMTLHCAYQPTHPIISFRRVACLIHHQDPLFLDL
IGTCHSDSIKPAILTPQHLTWYRTHLARGLTLYPPDILAAMLKEKKLERDEDGALILPIE
SLPMQELEDLPDQKYPNIPPMTEYFFDGTRDLAIFPPAVCLEPIDVDFGACPGPEAPNPV
PLCLRNYTKGKITVVWTGRSDCPFWVTPVTSDVPPLKSIALRLYFQPSSPNCLYAVELEA
FAVYKVLQCYSNIEEDCTVVPSWCLKVRARGHSYSPALEHHIPHYSLDSPQTFPAVSPGK
PSYRSLFLVNKGSMLMTFSLAPNSSSDITLRPSSGLIGPGAHQVFLISTYPKGTSWRQHI
FYLNFNFYPQYLKEVSMQSREEPLDLKLDTHKSIYFKPTWVGCSSTSNFTFHNPSRLPLQ
FEWRVSQEHQKVLAVQPSKGTIHPNENLTLTWIFSPLEEIKYLFRVGIWVWEARQSQKTK
PQATVHYRIRLVGMGVTGCLSAKPVELDFGNVLVNSQEVKPLVLLNDGNCTLYYRLVLEQ
HRPKGLHSDPCALEFDHSEGTMPPHSQDTIYLTARPKVRSQYSWTISYCLLSQRAPPTNS
MDGKKKALCHVSLAAAYPLLSVLDICSMGSTEGITRKHLWHLFSLDTLNSYLARDPTAKE
LTYKVPTRHSMSRTPPIFTPLKLDFNFGAAPHNALPSVVLLVLKNCGLVPLDWAFLFPSD
QQLDLDLWVEQEDLNSNELHQMRAEDNSLFSINPKTGSLNPGQEQMVEFTYRHLFVGTDR
LSVLFKVSHGREILLQFIGVTVKLEQKYVHFTSTIHQFIPVPIGDTLPPRQIYELYNGGS
VPVTYEVQVSVLSKVQEKNFDHPIFCCLNPKGDIQPGTTARILWIFSPIEAKTYTVEVPI
HIIGWNSAVVCFQGVGYDPCVMGDTAPFHSISSWDSSSISSRLMVPGQNVFLSQSHISLG
NIPVQSKCSRLFFLNNISKNETIVFTWKPRSLDFGEVTVSPMEGEVGPEEGAPILVTLKA
SVHASFYSIDLICKVYQRELMRQYHKELQEWNEEKARQEVEFTITDRKVKRRAYCAAHEP
PKKYKTLPPITNQPPLNRPATWNLKLAKKETSWPCPQPPVPGLLCLGLTARAHATDYYLA
NFFSEFPCHFLYRELPKKKSSKEESKSSEELPDKKGPVSRQKQQLLVDCLTSIIRGLLED
KNFHNAVDQNLVEQVPYFCQFWNEQSARFLAQKSSLYLVPILSLPPSYEGRKSKEQEEDL
FGKMPGGQEDDEEEEEDEEEAEEEEEEIEEEMSKDEEDIDKDAKMTWSGIKVTETSQHSL
QWQWQQDLKTIIKEETESDEKEAIGRLPAFANLQEAILENMIQNILVEASRGEVVLTSRP
RIIALPPVSMHRTDNLLQMSQGDVLCSGMQHPDCLLVSASSPSNMTT
NT seq 5544 nt   +upstreamnt  +downstreamnt
atgctcatccagaaaaaccaatgccacatcacgaggaccagggagaactgtgactgtaca
atgaacactgtgaatgaagatttgtgcctgagtgccagcacactgggaagtagcagtgtc
accacccagcttgtagatcccctggacaggaaaatatgcctcataaggaggcaaaatgat
gtgaaaaagagggtgatctggggcatcgaggtcgccgagaagctgcactggaaaggctgg
gagctgggaaaggagaccacaagaaccctggttctgaaaaacctctccctgaaaacccag
aagatgaagtacaggcctcccaagaccaagttcttcttcactatcattccacagcccatc
ttcctgagcccaggcataacgctcacacttcccattgtcttccgacctctagaagcgaag
gaatacacagaccagttgtggtttgaaaaagaagagggggtgttctgtgtgaccctgaag
gccaccttgccttgctacaagctagactgcccatcatctctgcaactgcccatgtgtgcc
cttggggacacagtggagacttggttctgtctgaacaatgtgggggacctgcccaccttc
ttcacctgggaagtcccagccccatttcagatactacccactacggggttactggagcca
ggcctgggttgtaagatcaaagtgacctttgagcccctcatagctgtcatccatgaagtt
gaggcattgtgctggtacggaaagggaaacaaacagaagaacagcattaacatacaggct
gcagctaaatgtgcacagctgctggtgagcataaagcacaaggggctagaggaccaggat
caggaaggcttccagaaggtggtacacttcggctatgtctccgtgggctccgtcgcagag
cggcaaatcaggctgtataacccatctgcggttaacgcccccttcaagatagaaatggcc
gaacacgtgctgaccaaagacccgagcttctcatgttccacaagccaaggcattgtgccc
ccgggggagaagaaatgcctgtcactgttctttcaccccaagactttggacagcagagcc
atcgactacttctccatcataccttctggctgtgccaccaaaactttgctccaggttgtt
ggtttctgtagaggtcccgatgcagtgctgcagcactcctgtgtcaacttccactgggtc
aagctcggggaacgccgggaacagactctgtggattgagaaccagtcagactgccaggct
cacttccagtttgatattgactgccaggagagtgtcttcagcatcaggcctgcctttgga
accctggcaggcaagactcgtatgaccctgcactgtgcctaccagcccactcaccctatc
atcagtttccggagggtggcttgtctcatccatcaccaggacccactgtttctggacctg
attgggacctgccattcagacagcatcaagccagccatcctgacacctcagcacctcact
tggtaccgaacacacctggctcggggcctgaccctctaccctcctgacattctggctgcc
atgctaaaggagaaaaagctggaacgggacgaggatggggccctcatattgcccattgag
tctctccctatgcaggaactggaggacctgccagaccaaaagtaccccaatatccctccc
atgacggagtacttttttgacggcaccagggacctggccatctttcccccagctgtctgt
ctagagcccattgatgtggactttggtgcctgtcctgggcctgaagcccccaaccctgtt
cctttatgcctgaggaactataccaaaggcaagatcaccgtggtctggactggcagatct
gactgccctttctgggtgaccccagtcactagtgacgtgcccccactcaagtccatagcc
ctgcgcctgtacttccagccgtcctctcccaactgcctctatgctgtggagctagaagcc
ttcgccgtttataaggtccttcagtgctacagcaatattgaagaggactgcacagtggtc
ccgtcatggtgtctgaaggttcgggctcgaggtcacagctattcccctgccttagaacac
cacatcccacactattccctggattcaccccagacgttcccagcagtgtctcctggaaaa
ccctcctacagaagcctgtttttggtcaacaaaggctccatgctcatgaccttcagcctg
gcccccaatagcagctcggacatcaccctgaggccctcctctggcctcatcggtcctgga
gcccaccaggtcttccttataagcacataccccaagggcacctcatggaggcagcacatt
ttctacctgaacttcaacttttatccccagtacctcaaggaagtgagcatgcagagcaga
gaggagcccctggatctgaagctggacacccacaaaagcatctacttcaagcctacctgg
gtgggctgttcctccaccagcaacttcacctttcacaacccctcacggctgcccctgcag
tttgagtggagagtctcacaagagcaccaaaaggtgctggccgtccagccgtccaagggt
accatccaccctaacgagaacctcacactaacgtggatcttcagccctctggaggagatc
aagtacctgttccgagtggggatctgggtctgggaagccagacagtcacaaaagaccaaa
ccccaagccactgtgcactacaggattcggctggtgggcatgggtgttactggatgcctc
tctgcaaagccagtggagctggacttcgggaacgtactggtgaacagccaggaagtcaag
cctttggtgctcttgaatgacggcaactgcaccctctattaccgcctggtcctggagcag
cacaggcccaagggcctccacagtgacccctgtgctctagaattcgaccactcggaaggg
accatgccgcctcattcccaggataccatctacctgactgcccgtccaaaagtccgttcc
caatattcctggaccattagctactgtctcctgtcccagagagcccctcccaccaacagc
atggatggcaaaaagaaagccctgtgccacgtgtccctggcagctgcatatcctttactc
tccgtcctggatatctgctccatgggtagcaccgagggcatcactcgcaagcacctgtgg
cacctcttctccctggacaccctcaatagttacttggcacgtgacccaactgccaaggag
ctcacctacaaggtgcccactcggcacagcatgagccgtacaccccccatcttcactcct
ctgaagctggacttcaattttggagcagcgccacacaatgccctgccctcagtggtactc
ctcgtactgaagaactgtgggctggtgcccttggactgggctttcctctttccaagtgac
cagcagctggacctggatctgtgggtagagcaggaagacctcaacagcaatgagctccac
caaatgcgtgcagaggacaattccctcttctccatcaaccccaagactgggagcttgaac
cctgggcaggagcagatggtagagttcacatacagacacctgtttgtcggcaccgatcgc
ctttctgtgctcttcaaggtgtcccatggacgggaaatcctgctacagttcatcggcgtg
acggtgaagctggagcagaagtatgtgcacttcacctctaccatccaccagttcattcct
gtccccatcggggacacactgcccccacgccagatttacgagctgtacaatggcggctca
gtacctgtgacatatgaggtccaggtcagcgttctgtcaaaggttcaagaaaaaaatttt
gaccatcctattttctgctgcctgaaccccaaaggggacatccagccaggtactactgct
cggatcctgtggatcttctcacccatcgaggccaagacctacacggtggaggtacccata
cacatcattggatggaactcagcggtcgtctgcttccaaggagtaggatatgacccctgt
gtcatgggtgacaccgcccctttccacagcatctcttcgtgggacagcagttccatatcc
tctaggttgatggttcctgggcagaatgtcttcctgtcccagtctcacatctccctggga
aacatccctgtgcagagcaagtgtagccgcctgttttttctcaacaacatctccaagaat
gagacaattgtcttcacctggaagccaaggtccttagactttggagaggtaactgtgagt
cccatggaaggagaagtgggtcctgaagagggagccccaatcctagtgaccctgaaggcc
tcggttcatgccagcttctacagcatagacttgatatgcaaggtataccagcgggaactt
atgcggcagtatcacaaggagctacaggaatggaatgaagagaaggctcgacaggaggtg
gagttcaccatcacagatcggaaagtaaagaggagagcatactgtgcagcccatgaaccc
ccaaagaagtacaagacgctgcctcccatcacaaaccaaccgcctctcaaccggcctgct
acctggaacctgaaattggcaaagaaggagacatcatggccatgccctcaaccccctgtg
ccaggcctgctgtgtctaggcctcaccgcaagggcccatgccacagactactacctggcc
aacttcttctctgagttcccctgccacttcctgtaccgggagctgccaaagaagaaatcc
tccaaggaagagtcaaaatcttctgaagaactccctgacaaaaagggtcctgtctctcgg
cagaagcagcagcttctggtggactgcctcaccagcatcatccggggtctattggaagac
aagaatttccataatgctgtggaccaaaacctggtggagcaggtgccttacttctgccag
ttctggaatgagcagtcagccaggttcctagcccagaaaagcagcttgtacttagtgccg
atcctgtccctgccgcccagctatgagggcaggaaaagcaaggagcaggaggaggacctt
tttgggaagatgccaggggggcaagaggatgatgaagaggaagaggaagatgaggaggag
gcagaagaggaagaggaggagatagaagaggagatgagcaaggacgaggaggacatagac
aaggatgcaaagatgacctggtcagggattaaggtcacagagacctcccagcactctctg
cagtggcaatggcagcaggatctgaagaccataataaaggaggagacagaaagtgacgag
aaggaggccattgggaggctaccagcttttgccaacctgcaggaagcaatactggagaac
atgattcagaacatcctggtagaggcaagccgtggagaggtagtgctcacttcgaggccc
cgcatcattgccctaccaccagtcagcatgcacaggacagacaacctcttgcagatgtca
caaggggacgtgctctgctctgggatgcagcatcctgactgtttgctggtgtcagcatcc
agcccctctaacatgactacctaa

DBGET integrated database retrieval system