KEGG   Mus musculus (house mouse): 241159
Entry
241159            CDS       T01002                                 
Symbol
Neu4, 9330166I04
Name
(RefSeq) sialidase 4
  KO
K12357  sialidase-2/3/4 [EC:3.2.1.18]
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu00511  Other glycan degradation
mmu00600  Sphingolipid metabolism
mmu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    241159 (Neu4)
  09107 Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    241159 (Neu4)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.18  exo-alpha-sialidase
     241159 (Neu4)
SSDB
Motif
Pfam: BNR_2 BNR_3 BNR
Other DBs
NCBI-GeneID: 241159
NCBI-ProteinID: NP_776133
MGI: 2661364
Ensembl: ENSMUSG00000034000
UniProt: Q8BZL1
Position
1:93948215..93956056
AA seq 478 aa
MGPTRVPRRTVLFQRERTGLTYRVPALLCVPPRPTLLAFAEQRLSPDDSHAHRLVLRRGT
LTRGSVRWGTLSVLETAVLEEHRSMNPCPVLDEHSGTIFLFFIAVLGHTPEAVQIATGKN
AARLCCVTSCDAGLTWGSVRDLTEEAIGAALQDWATFAVGPGHGVQLRSGRLLVPAYTYH
VDRRECFGKICWTSPHSLAFYSDDHGISWHCGGLVPNLRSGECQLAAVDGDFLYCNARSP
LGNRVQALSADEGTSFLPGELVPTLAETARGCQGSIVGFLAPPSIEPQDDRWTGSPRNTP
HSPCFNLRVQESSGEGARGLLERWMPRLPLCYPQSRSPENHGLEPGSDGDKTSWTPECPM
SSDSMLQSPTWLLYSHPAGRRARLHMGIYLSRSPLDPHSWTEPWVIYEGPSGYSDLAFLG
PMPGASLVFACLFESGTRTSYEDISFCLFSLADVLENVPTGLEMLSLRDKAQGHCWPS
NT seq 1437 nt   +upstreamnt  +downstreamnt
atggggcccacgcgtgttcccaggagaacggtgctcttccagagggaaaggacgggcctg
acctaccgtgtgcctgcgttactctgtgtgcctcccaggcctactctgctggccttcgcg
gaacagcgacttagccctgatgactcccatgcccaccgcctggtgctacggaggggcacg
ctgaccaggggctcagtgcggtggggcactctgagtgtactggagactgcagtactggag
gagcacaggtctatgaacccttgcccggtgctggatgagcactctggtaccatcttcctc
ttcttcattgccgtgctgggccacacaccggaggccgtgcaaatcgccactggcaagaac
gctgctcgcctctgctgtgtgaccagctgtgacgctggcctcacctggggcagtgttcga
gatctcactgaggaagccattggtgctgcattgcaggactgggccacctttgctgtgggt
ccgggccatggagttcagctgcgctcgggtcgcctgcttgttcctgcttacacctatcat
gtggaccgacgggaatgttttggcaagatctgctggaccagtccccactccttggcattc
tacagtgatgatcatgggatctcctggcattgtggaggccttgtgcccaacctacgctct
ggagagtgccaactggctgcggtagatggagactttctctactgtaatgctcgaagccct
ctgggtaaccgtgtgcaggcactgagtgctgatgaaggcacgtccttcctaccaggggag
ctggtgcctacattggcagagacggctcgtggttgccagggtagcattgtgggcttccta
gctccaccctcaatcgagcctcaggatgaccggtggacagggagtcctaggaacacccca
cattccccatgcttcaatctcagagtacaggagtcttcgggggaaggtgccagaggtctt
cttgaacgttggatgcccaggttgcctctctgctacccacagtcccggagcccagagaat
catggcctagagcctgggtcagatggagataagacatcctggactccggaatgtcctatg
tcctctgattccatgcttcagagccccacatggctactatattcccacccagcagggcgt
agagctcggctccacatgggaatctacctgagccgatcccccttggatccccacagctgg
acagagccctgggtgatctatgagggccccagtggctactctgaccttgcctttcttggg
cctatgcctggggcatccctggtttttgcctgtctgtttgagagcgggaccaggacttcc
tatgaagacatttctttttgcttgttctcactggcggatgtcctggagaatgtgcccact
ggcttagagatgctaagtctcagggataaggctcaggggcattgctggccctcttga

DBGET integrated database retrieval system