KEGG   Mus musculus (mouse): 241175
Entry
241175            CDS       T01002                                 

Symbol
Cntnap5b, C230078M14Rik, Caspr5-2
Name
(RefSeq) contactin associated protein-like 5B
  KO
K24338  contactin associated protein-like 5
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:mmu04990]
    241175 (Cntnap5b)
Domain-containing proteins not elsewhere classified [BR:mmu04990]
 Laminin domain-containing proteins
  Laminin G domain-containing proteins
   241175 (Cntnap5b)
SSDB
Motif
Pfam: Laminin_G_2 Laminin_G_1 F5_F8_type_C EGF Laminin_G_3 PepSY_TM_like_2 Activator_LAG-3 EGF_2
Other DBs
NCBI-GeneID: 241175
NCBI-ProteinID: NP_766439
MGI: 3664583
Ensembl: ENSMUSG00000067028
Vega: OTTMUSG00000048875
UniProt: Q0V8T8
Position
1:99700006..100418324
AA seq 1292 aa
MDSVPRLTSILTLVLSGLWHVGLTATNYNCDDPLASFLSPKAFSSSSDLTGSSSSAQLNG
RMGTGGWSPENSSAHQWLQLDLGNRVEITAVATQGRYGSSDWVTSYCLIFSDTGHNWQQY
KQGDSIWTFIGNMNANSVVHHKLLHAVRARFVRFVPLEWNPNGKIGMRVEVYGCFYKSDV
ADFDGRSSLLYRFNQKTMSTLKDVISLKFKSMQGDGVLFHGEGQRGDHITLELQNGRLAL
YLNLDDSKARLSSITPSAILGSLLDDQHWHSVLLERVGKQANFTVDRNTQHFRTNGDTDA
LDIDYELSFGGIPVPSKPGTFLKKNFQGCIENLYYNGVNIIDLAKRRKHQIYSGNVTFSC
SEPQIVPITFVNSRSSYLLLPGTPQIDGLSVSFQFRTWNEDGLLLSTELSEGSGTLLLIL
EGGTLRLLIKNVAGHGTESLTGRSLNNGQWHSVNINARRNRVTLTLDNDPASPALETPWL
QIYSGYSYYFGGCPDNLTDSQCLNPIKAFQGCMRLIFIDNQPKDLISVQQGSLGNFSDLH
IDLCSIKDRCFPNYCEHGGHCTQTWTNFYCNCSNTGYTGATCHDSIYEQSCEVYRHRGNT
AGYFYVDSDGSGPLRPLQVYCNVTEDKIWMTVQHNNTELTWIQGSNTEKPYVMNLNYGGS
MEQLEALIDGSEHCEQEVTYYCRRSHLLNTPDGAPFAWWTGRSNERHPYWGGYFPGDQKC
GCGLEESCLEMSNDTGFLSFKDHLPVTQIIISDTNRSNSEAAWRIGPLRCYGDRHFWNAV
SFSTEAAYLHIPTFHAEFSADISFFFKTTALSGVFLENLGVKNFLRLEMSSPSEVIFAID
VGNGPMELLVQSPYPLNDNQWHYIQAERNIKETLLHVDNLPKSMRMASEEGHFLLQLNSQ
LFVGGTSSRQKGFLGCIRSLHLNGQKVDLEERAKITSGVRPGCAGHCNSYGRNCQNGGKC
VEKHIGYTCDCTNSPYEGPFCKKEISALFYSGTSVTYMFQEPYPVTKNTSLSSSAIYKDT
APSKEAITLSFMTAQAPTLLLYLNFSSQNFLAILLSRNGSLQIQYRLSKEESHVFTISTE
NLANRRVHQVKMSRDGPELSIQMDQQLFSYNFPPEVEFQTVRSLILGKVTETLGLDPEVA
KANTLGFVGCLSSVQYNHIAPLKAALRHASISPVTVQGTLTESSCDSMIDSDVTGVTTVY
SPSVPFGKTDEHEPLTNTIQSDSAFIGGVIAIVTFITFCVLGIMVHFLYQQKQSHRTNQM
KEKEYPDNLDSSFRNDIDLQNTAIECKREYFI
NT seq 3879 nt   +upstreamnt  +downstreamnt
atggattctgtaccaagactgaccagcattttgactttggtgctgtctggcttgtggcac
gttggattaacagcgacaaattacaattgtgatgacccattggcctctttcctctcaccg
aaggctttctccagttcctcagatctcactggaagttccagctcagctcaactgaatggg
agaatgggaactggtggttggtctccagaaaattccagtgcccatcagtggctgcagttg
gacctgggaaacagagtagagattacagcagtggccacacagggaagatatgggagctct
gactgggtgacaagctattgcctgatattcagcgacacagggcacaactggcaacagtac
aagcaaggagacagcatctggacatttataggaaacatgaatgctaacagtgtagttcac
cacaagctactgcacgctgtgagagcccgctttgttcgctttgtgcccttggaatggaat
ccaaacggaaagattggcatgagagtggaggtctatggatgcttctacaaatcagatgtt
gctgactttgatggccggagctcacttttgtacaggttcaatcagaagacaatgagtacc
ctcaaagatgtgatctccctgaaattcaagagcatgcaaggagatggggttctgttccat
ggggaaggacaacgtggagaccacatcaccctagagctccagaatggaagactagcccta
tacctgaacttggatgatagcaaagcccgcctcagtagtattacaccctcagccattctg
ggtagccttctggatgaccagcactggcactcagttctcctggagcgtgtgggaaagcaa
gcaaacttcactgtggacaggaacacccagcactttcggaccaacggtgacactgatgcc
ctggacatcgactatgagctcagttttggaggaattccagtaccaagtaaacctgggacc
tttttaaagaaaaacttccaaggctgtattgaaaacctttactacaatggagtgaacata
attgacttggctaaaagacgcaagcatcagatctactccggcaatgtcaccttttcctgc
tcagaaccacaaattgtacctatcacatttgtcaactccaggagcagttatttgctgcta
cctggcaccccccaaattgatggtctatcagtgagtttccagtttcgaacatggaatgag
gatggtctgcttctgtccacagagctgtctgaaggctcaggaaccctgctgctcattctg
gagggcgggactctgagactcctgattaagaacgtggcaggacatggaactgaaagcctc
acaggcagaagcttgaataatggccagtggcattctgtcaacatcaatgcaaggagaaat
cgtgttactctcacactggataatgatcctgcttctccagctctggaaaccccctggcta
cagatatattctggatatagttactactttggagggtgccctgacaatctcaccgattcc
caatgcttaaatcccattaaggctttccaaggctgcatgaggctcatctttattgataac
cagcccaaggacctcatttcagttcagcaaggttccctggggaattttagtgatttacac
attgatctgtgtagcatcaaagacaggtgtttccccaactactgtgaacatggaggacac
tgtactcaaacctggacaaacttctactgcaactgcagtaatactggttacacaggagcc
acctgtcatgattccatctatgagcaatcctgtgaggtatacagacacagaggaaacaca
gctgggtacttctatgttgactctgatgggagcggcccactgagaccactccaggtgtac
tgcaatgttactgaggacaagatctggatgacggttcaacacaacaacacagagttgact
tggatacagggttccaacactgagaaaccctatgtcatgaacttaaattatggtgggagt
atggagcagctggaggctctgattgatggctcagagcactgtgaacaggaggtaacatac
tactgtaggagatcacacctgcttaacacaccagatggagccccatttgcctggtggact
gggaggtccaatgagaggcacccttactggggaggttattttcctggagaccagaagtgt
ggatgtggcctagaggagagctgcctggagatgtcaaacgatactggttttctttccttc
aaagatcacttgcctgtaactcagataattatcagtgataccaacagatcaaactcagaa
gcagcttggagaattggccccttgcgttgctatggtgaccgacacttctggaatgctgtc
tcattttctactgaagctgcttacctccacattcctaccttccatgcagaattcagcgct
gatatttccttcttttttaaaaccactgctttatctggcgttttcctagaaaaccttggc
gttaaaaacttcctccgacttgaaatgagctctccttctgaagtcatattcgccattgat
gttgggaatggtcctatggaactccttgtccagtctccttatcctctgaatgacaaccaa
tggcattacatccaggctgagagaaacatcaaggagaccttattacatgtagacaacctt
ccgaagagtatgaggatggcctcagaggaaggccattttctgcttcagctgaatagccag
ttgtttgtaggggggacatcatcaagacagaaaggctttcttggatgcatccgttcatta
cacttgaatgggcagaaagtagacctggaagagagggcaaagatcacatctggagtcaga
cctggctgtgcaggtcactgcaacagctatggaaggaactgccaaaatgggggcaagtgt
gtggagaagcatattggctacacctgtgactgtaccaactcaccatatgaaggacctttc
tgcaagaaagagatttcagcacttttttattctgggacctctgttacatacatgtttcaa
gaaccatacccggtgaccaagaacacaagcctctcatcttcagctatctacaaagataca
gctccatccaaggaagccatcacactgagttttatgacagcacaagctcccaccctcttg
ctctacctcaatttctcttctcagaattttctggctattctgctctccaggaatggaagt
ttacagattcaatatcgactaagcaaggaagaaagtcatgtgttcaccatcagcacagag
aatcttgccaatagaagagtacaccaggtgaagatgagccgagatgggccagaactttcc
attcagatggaccagcaactcttcagctataacttccccccagaagtggagttccaaaca
gtgaggtcactcatcctaggcaaagttacagaaactcttgggttggatccagaagttgct
aaagcaaatacactgggttttgttggatgcctctcttcagtccaatataaccatatcgca
ccattgaaggcagccctccgccatgccagcatttctcctgtgactgttcaagggactttg
acagagtccagctgtgactccatgatagactctgatgtgactggagtgactactgtttat
tctccatcagttccctttggaaagacagatgagcatgaaccactcacaaatacaatccag
agtgactcagcattcattggaggtgtcatagcaattgtaacatttatcactttttgtgtc
cttggaatcatggtgcacttcctctatcagcaaaagcagtcacaccgtaccaatcagatg
aaggagaaggaatacccagacaacttggacagttcctttagaaatgacattgacttgcaa
aacacagccatcgagtgcaaacgggaatacttcatctga

DBGET integrated database retrieval system