KEGG   Mus musculus (mouse): 241226
Entry
241226            CDS       T01002                                 

Gene name
Itga8, AI447669
Definition
(RefSeq) integrin alpha 8
  KO
K06584  integrin alpha 8
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04151  PI3K-Akt signaling pathway
mmu04510  Focal adhesion
mmu04512  ECM-receptor interaction
mmu04514  Cell adhesion molecules
mmu04810  Regulation of actin cytoskeleton
mmu05165  Human papillomavirus infection
mmu05410  Hypertrophic cardiomyopathy
mmu05412  Arrhythmogenic right ventricular cardiomyopathy
mmu05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    241226 (Itga8)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    241226 (Itga8)
   04514 Cell adhesion molecules
    241226 (Itga8)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    241226 (Itga8)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    241226 (Itga8)
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    241226 (Itga8)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    241226 (Itga8)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    241226 (Itga8)
   05414 Dilated cardiomyopathy
    241226 (Itga8)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:mmu04515]
    241226 (Itga8)
Cell adhesion molecules [BR:mmu04515]
 Integrins
  Integrin alpha subunits
   241226 (Itga8)
SSDB
Motif
Pfam: Integrin_alpha2 FG-GAP VCBS Integrin_alpha LYRIC
Other DBs
NCBI-GeneID: 241226
NCBI-ProteinID: NP_001001309
MGI: 109442
Ensembl: ENSMUSG00000026768
Vega: OTTMUSG00000011364
UniProt: A2ARA8
Position
2 A1; 2 9.12 cM
AA seq 1062 aa
MSAGTHCGPPGNRAPPFARLCCVSAALGMLWSPACLAFNLDVDKLTVYSGPEGSYFGYSL
DFYIPDARTASVLVGAPKANTSQPDIVEGGAVYYCPWPSERSAQCKQIPFDTTNNRKIRV
NGTKEPIEFKSNQWFGATVRAHKGKVVACAPLYHWRTLKPNPAKDPVGTCYVAIQNFSAY
AEHSPCRNSNADPEGQGYCQAGFSLDFYKNGDLIVGGPGSFYWQGQVITVSIADIIANYS
FKDILRKLAAEKQTDVAPASYDDSYLGYSVAAGEFTGDSQQELVAGIPRGAQNFGYVSII
NSTDMTFIQNFTGEQMASYFGYTVVVSDVNNDGMDDILVGAPLFMEREFESNPREVGQVY
LYLQASALLFQDPQVLTGTETFGRFGSSVAHLGDLNQDGYNDIAIGVPFAGKDQRGKVLI
YNGNPRGLHSKPSQVLQGIWGSQTIPSGFGFSLRGDADIDKNDYPDLLVGAFGKGKVAVY
RARPVVTVDAQLLLHPMIINLENKTCQIPEFPTPVACFSVRVCASIAGQSISNTIALLAE
VQLDFLKQKGAIKRTLFLHNHQSHFTFPFVMKQQKSLHCQDFMVYLRDETEFRDKLSPIN
ISLNYSLDDSTFKDSLEVKPILNHYRDNVVTEQAHILVDCGEDNLCVPDLKLSARPDKHQ
IIIGDENHLMLIINARNEGEGAYEAELFVIIPEEADYVGIERNNKGLRPLSCEYKMENVT
RMVVCDLGNPMVTGTNFSLGLRFAVPRLEKTNMSINFDLQIRSSNKDNPDSNFERVQINI
TAIAQVEIRGVSHPPQIVLPIHNWEPEKKPHKEEEVGPLVEHIYELHNIGPSTISDSILD
VGWPFSARDEFLLYIFHLQTLGPLQCQTNPEINPQDIKPAASPEDTPELSAFLRNATIPH
LVRKRDVPVVQLHRQSPARILNCTNIDCLQISCAVGRLGGGESAVLKVRSRLWAHTFLKR
KNDHYALASLVSFEVKKMPYKEQPAKLPAGSTAVKTSVIWATPNVSFSIPLWVIILAILL
GLLVLAILTLALWKCGFFDRARPPQDEMTDREQLTSDKTPEA
NT seq 3189 nt   +upstreamnt  +downstreamnt
atgtctgcgggaacccactgtggtcccccggggaaccgggcacctccgttcgcgcgtctc
tgttgcgtctcggccgcgctggggatgctgtggtcccctgcgtgtctggcgttcaacttg
gatgtggacaagctcactgtgtacagtggccccgagggcagctacttcggctactcactg
gacttctacatacctgatgcgcgcacagccagtgtcttagtgggggcacccaaagccaac
actagccagccggatatcgtagaagggggagctgtctactactgtccctggccctcagag
aggtctgcacagtgcaagcagataccgtttgacaccaccaacaacaggaaaatcagagtt
aatggaaccaaagaacctatagaatttaaatcaaaccagtggtttggagccacagtgaga
gctcacaaaggaaaagttgtggcttgtgcccctttgtatcactggagaactctgaaacct
aatccagcgaaggacccagttggcacatgctatgtagcaattcagaatttcagtgcctat
gctgagcactcaccttgtcgaaacagcaatgctgatcccgaaggccaaggttactgccag
gcagggtttagcctagacttctataagaatggagaccttatagtgggaggacctggaagt
ttttactggcaaggtcaggtgatcactgtcagtatagcagacatcattgcaaattactca
ttcaaggatattctacgaaaattggccgcagaaaagcagacagacgtggctccagcttcc
tatgatgacagctaccttggatattcggtcgctgctggagaattcactggggactctcag
caagaattggtggctgggattccaagaggagcacagaactttggatatgtctccatcatt
aactccacagacatgaccttcattcagaattttactggtgagcagatggcatcttatttc
ggatatactgttgtggtatcagatgttaacaatgatggcatggatgacatattggtcggg
gcacctctctttatggagcgagaatttgaaagtaaccctagagaagtgggacaggtctac
ttgtaccttcaagcaagcgccctcctcttccaagacccacaggtcctcaccggcacggag
acatttgggagatttggtagctctgtggcccacttgggggacctgaaccaagatggatac
aatgacatcgccatcggtgtgccctttgcaggcaaggatcaacgaggtaaagtcctcatt
tacaatggaaacccaagaggtttacacagcaagccttcccaagttctgcaaggaatatgg
gggtcacagaccatcccttctggatttggcttttctctaagaggagatgcagacatagac
aagaatgattacccagatttgcttgtaggggcatttggaaaagggaaagtagctgtttac
agagcaaggccagttgtaaccgtggatgcccagcttctgctgcacccgatgattatcaac
cttgaaaataaaacttgccagattccagaattccctactcctgtggcctgcttttctgta
agagtctgtgcatctatagcaggccagagcatttcaaatacaatagccctgctggccgag
gtgcagttagatttcctgaagcaaaaaggagccatcaaacggacgctctttctccacaac
caccagtcccatttcaccttcccctttgtgatgaagcagcagaaatccctccactgccag
gattttatggtttaccttcgggatgaaactgaattccgagataaattgtctccaatcaac
atcagcctgaactacagtttggatgattctacctttaaagacagcctggaagtgaagcca
attttgaaccactacagggacaatgtagttactgagcaggctcacatcctggtggactgt
ggagaagacaatctatgcgttcctgacttgaagctgtcagctagaccagataagcatcag
ataattattggcgatgaaaatcacctaatgctcataataaatgcaagaaatgagggagaa
ggggcctacgaagccgaactctttgttatcatccccgaagaagcagattatgttgggatt
gagcgcaacaacaagggactgaggcccctgagttgtgagtacaagatggaaaacgtgacc
aggatggtggtgtgtgaccttgggaacccgatggtgactggaacaaatttttctctgggc
ctccgatttgctgttcctcgccttgagaaaacaaatatgagcattaacttcgatctccaa
atcagaagctccaataaggacaatcctgacagcaacttcgagcgtgtacagatcaacatc
actgccattgctcaggtcgaaatcagaggagtgtcccaccctccgcagattgttctgccc
atccacaactgggaaccagaaaagaagccacacaaagaggaggaagtcggtcctttggtt
gagcatatttatgagctgcacaatattggacccagcaccatcagtgacagcattcttgac
gtgggctggccgttctctgcacgggatgagtttctcctctatatttttcatcttcaaact
ctgggacctctacaatgtcaaacaaatcctgagatcaacccacaggatataaagcctgct
gcctccccagaggatacccctgagctcagtgccttcttaagaaatgctacaattccccat
cttgtcagaaagagggatgtgccagtggtccagctccacagacagagccctgcaagaata
ctgaactgtaccaacattgactgcttgcaaatctcttgtgcagtgggtcgcctgggagga
ggcgaaagtgcagtcctaaaggtcagatcgagattgtgggcccacacgttcctcaagaga
aagaatgatcattatgctcttgcatccctggtgtcctttgaagtcaagaagatgccgtat
aaagaacagccagcaaagctgccagcggggagcacagcggttaagacgtcggttatttgg
gccactccgaatgtctccttctcaattccattgtgggtcataatactagcgatccttctt
ggtttgctggttctggctatcttaactttagctttatggaagtgtggattctttgataga
gcaagacctcctcaggatgaaatgacagacagggaacaactgaccagtgacaagacccca
gaggcgtga

DBGET integrated database retrieval system