KEGG   Mus musculus (mouse): 241263Help
Entry
241263            CDS       T01002                                 

Gene name
Gpr158, 5330427M13Rik, mKIAA1136
Definition
(RefSeq) G protein-coupled receptor 158
  KO
K08469  G protein-coupled receptor 158
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mmu04030]
    241263 (Gpr158)
G protein-coupled receptors [BR:mmu04030]
 Metabotropic glutamate receptor family
  Unclassified GPCRs
   241263 (Gpr158)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_3 EGF_3
Motif
Other DBs
NCBI-GeneID: 241263
NCBI-ProteinID: NP_001004761
MGI: 2441697
Ensembl: ENSMUSG00000045967
Vega: OTTMUSG00000011438
UniProt: Q8C419
Position
2; 2 A3
AA seq 1200 aa AA seqDB search
MGAMAYSLLFCLLLAHLGLGEVGASLDPPGRPDSPRERTPRGKQHGQQLPRASAPDPSIP
WSRSTDGTILAQKLAEEVPVDVASYLYTGDFHQLKRANCSGRYELAGLPGKSPSLASSHP
SLHGALDTLTHATNFLNMMLQSNKSREQTVQDDLQWYQALVRSLLEGEPSISRAAITFST
ESLSTPAPQVFLQATREESRILLQDLSSSAHHLANATLETEWFHGLRRKWRPHLHRRGSN
QGPRGLGHSWRRRDGLGGDRSHVKWSPPYLECENGSYKPGWLVTLSAAFYGLQPNLVPEF
RGVMKVDISLQKVDIDQCSSDGWFSGTHKCHLNNSECMPIKGLGFVLGAYQCICKAGFYH
PRVFSVNNFQRRGPDHHFSGSTKDVSEETHVCLPCREGCPFCADDRPCFVQEDKYLRLAI
ISFQALCMLLDFVSMLVVYHFRKAKSIRASGLILLETILFGSLLLYFPVVILYFEPSTFR
CILLRWARLLGFATVYGTVTLKLHRVLKVFLSRTAQRIPYMTGGRVMRMLAVIVLVVFWF
LVGWTSSMCQNLERDILLVGQGQTSDHLTFNMCLIDRWDYMTAVAEFLFLLWGIYLCYAV
RTVPSAFHEPRYMAVAVHNELIITAIFHTIRFVLASRLQPDWMLMLYFAHAHLTVTVTIG
LLLIPKFSHSSNNPRDDIATEAYEDELDMGRSGSYLNSSINSAWSEHSLDPEDIRDELKK
LYAQLEIYKRKKMITNNPHLQKKRCSKKGLGRSIMRRITEIPETVSRQCSKEDKEGTDHS
AAKGTGLVRKNPTESSGNTGRPKEESLKNRVFSLKKSHSTYDHVRDQTVESSSLPMESQE
EEATENSTLESLSSKKLTQKLKEDSEAESTESVPLVCKSASAHNLSSEKKPGHPRTSMLQ
KSLSVIASAKEKTLGLAGKTQTLVMEDRAKSQKPKDRETIRKYSNSDNVETIPNSGHMEE
PRKPQKSGIMKQQRVSLPTANPDVSSGITQIKDNFDIGEVCPWEVYDLTPGPMPSEPKAQ
KHVSIAASEVEQNPASFLKEKSYHKSKATEGLYQANHKSIDKTEVCPWEIHSQSLLEDEN
RLISKTPVLPGRAREENGSQLYTTNMCAGQYEELPHKVVAPKVENENLNQMGDQEKQTSS
SVDIIPGSCNSSNNSHQPLTSRAEVCPWEFEPLEQPNAERSVTLPASSALSANKIPGPQK
NT seq 3603 nt NT seq  +upstreamnt  +downstreamnt
atgggagccatggcttactctttactcttctgcctcctgctcgctcatctgggattggga
gaggttggtgccagcctcgaccctccgggacggccagattcccctcgagagaggactccg
agggggaagcagcatggtcagcagctgccgcgagcctctgccccagacccctctattccc
tggagccgctccactgacggcaccatcttggcacaaaaactagccgaggaggtgcccgtg
gacgtggcctcttacctctacactggggacttccaccagctgaagagagccaactgctca
ggccgctacgagttggctggcctgccgggaaagtcaccgtccctagccagctcccatcct
tccttgcacggggcgctggacactctgacacacgccaccaacttcctcaacatgatgttg
cagagcaataagtctcgggaacagaccgtgcaggatgacctgcagtggtaccaggctctg
gtgcgaagtctcctggagggtgagcccagcatctcccgggcggccatcaccttcagcacc
gagtcgctgtccacgcccgccccgcaggtcttcctccaggccacccgcgaggagagtcgc
atcctgctgcaggacctgtcctcctccgctcaccacctggctaacgccactctagagacc
gagtggttccatgggcttcggcgaaagtggaggccccacttgcaccgccgtggctccaat
caggggccacggggcctaggccacagctggcggcgcagggatgggcttggaggggacagg
agccacgtcaagtggtccccaccttatctggagtgcgagaatgggagttacaagcctggg
tggctggtcacgctctctgctgccttctacgggcttcaacctaacctggtcccggaattc
aggggtgtgatgaaagttgatataagccttcagaaagtggacattgaccaatgttcgagt
gatggctggttttcaggaactcacaaatgccaccttaacaactcagagtgtatgccaatc
aaaggcctgggattcgtgcttggagcctatcagtgcatttgcaaagcagggttctatcat
ccccgtgtcttctcagtgaacaacttccagagaaggggtccagatcaccatttttcagga
agcacaaaggatgtgtcagaagaaacccacgtctgcctgccctgcagagaaggctgcccc
ttctgtgctgatgatcgtccatgctttgtccaggaggataaatacctgcggctcgctatt
atctctttccaagccctgtgtatgctgctggactttgtcagcatgctggtggtctaccat
tttcgcaaagcaaagagcatcagggcatctgggctcatcctgttggaaacaatattgttt
ggttctctgctcctatactttccggtcgttattctgtactttgagccaagtacatttcgt
tgtattctcctaaggtgggctcgtcttcttggttttgctactgtttatggaactgtgacc
ctcaagcttcacagggttttgaaggtgttcctttcacgaacagcacaaagaatcccatac
atgactggtggtcgggtcatgaggatgctggcagtaatagtcttggttgtgttttggttt
cttgttggctggacttcttctatgtgccagaatttggagcgggatattttgcttgttggc
caagggcaaacatctgatcacctcaccttcaatatgtgcctcattgaccgctgggattac
atgacagcagttgctgaatttttattcctcttgtggggcatttatctctgctatgcagtg
cggactgtcccttcagcatttcatgagccacgctacatggctgtcgcagttcacaatgag
ctcattatcacggctatattccatacaattagattcgtgctcgcctcgagacttcagccc
gactggatgctgatgctgtactttgcacatgctcacttgactgtgacagtcaccattggg
ctgcttctaattccaaagttttcacattcaagcaataatccccgagatgacattgctacg
gaagcatatgaagatgagctggacatgggtcgctctggatcctacctgaacagcagtatc
aattcagcctggagtgaacacagcctagatccagaagacattcgggatgaactgaaaaaa
ctctatgctcagttagaaatatacaaacgtaaaaagatgatcacaaacaacccccacctt
cagaaaaaacggtgctccaagaagggcttaggccggtccatcatgaggcgcatcactgag
atcccagagacagtcagcagacagtgctccaaagaggacaaggaaggcacagaccacagt
gcagccaaggggacaggccttgtccggaagaaccctactgagtcctcagggaatacaggg
agacccaaggaagagtcccttaaaaatcgggtcttctctctcaagaaatcccacagcaca
tatgaccatgtgagagaccaaactgtagaatccagcagcttgcccatggagagccaggag
gaggaggccaccgaaaattcaaccttggagtcgctgtcaagtaaaaaactgacacaaaag
ctcaaagaagatagtgaggccgagtccactgagtcagtgccgttggtctgcaagtcagcc
agtgctcacaacctcagctcagagaagaagcctgggcacccacgtacatctatgttacag
aaatctctcagtgtcattgcaagtgccaaggagaagacacttggcctggctggcaaaacc
cagactttagttatggaagaccgagctaagtcccagaaaccaaaagatagagagaccatc
aggaagtactcaaattcagataatgtagagactatcccaaactccggtcacatggaggag
ccaagaaagccccagaaatctgggattatgaaacagcagagggtcagcctccccactgcc
aatcctgacgtgagctccggtatcacccagataaaggacaattttgatatcggagaagta
tgcccttgggaggtttatgacctgacccctggtcctatgccttcagagccaaaagctcaa
aaacacgtatcaatcgcagcttctgaagtggaacaaaaccctgcttcgtttttgaaggag
aagtcctaccacaagtctaaggcaactgaaggtctctaccaagccaatcacaagagcata
gacaagacagaggtgtgcccctgggaaatccacagtcagtcccttttagaagatgagaat
cgtctgatttctaagactccagttctcccagggagagccagagaggagaatggaagccag
ctctacacaaccaatatgtgtgctgggcaatatgaagaactgccccacaaagtcgtagca
ccaaaagtagagaatgaaaatctcaaccaaatgggagaccaggagaaacagacatcttcc
tctgtggatatcattcctggctcctgtaactcaagtaataactcccatcagcccttaaca
tcacgagccgaagtgtgtccctgggagttcgagcccctagaacaaccaaatgctgaaaga
agcgtaactttacctgcctcctctgctttaagtgcaaataagataccagggcctcagaaa
tag

DBGET integrated database retrieval system