KEGG   Mus musculus (mouse): 24128
Entry
24128             CDS       T01002                                 

Symbol
Xrn2
Name
(RefSeq) 5'-3' exoribonuclease 2
  KO
K12619  5'-3' exoribonuclease 2 [EC:3.1.13.-]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03008  Ribosome biogenesis in eukaryotes
mmu03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09122 Translation
   03008 Ribosome biogenesis in eukaryotes
    24128 (Xrn2)
  09123 Folding, sorting and degradation
   03018 RNA degradation
    24128 (Xrn2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:mmu03021]
    24128 (Xrn2)
   03019 Messenger RNA biogenesis [BR:mmu03019]
    24128 (Xrn2)
   03009 Ribosome biogenesis [BR:mmu03009]
    24128 (Xrn2)
   03016 Transfer RNA biogenesis [BR:mmu03016]
    24128 (Xrn2)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.13  Exoribonucleases producing 5'-phosphomonoesters
    3.1.13.-  
     24128 (Xrn2)
Transcription machinery [BR:mmu03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Transcription termination factor
     24128 (Xrn2)
Messenger RNA biogenesis [BR:mmu03019]
 Eukaryotic type
  mRNA degradation factors
   5'-3' decay
    5' exonucleases
     24128 (Xrn2)
Ribosome biogenesis [BR:mmu03009]
 Eukaryotic type
  Pre-60S particles
   RNases
    24128 (Xrn2)
Transfer RNA biogenesis [BR:mmu03016]
 Eukaryotic type
  tRNA degradation factors
   Rapid tRNA decay (RTD) pathway factors
    24128 (Xrn2)
SSDB
Motif
Pfam: XRN_M XRN_N
Other DBs
NCBI-GeneID: 24128
NCBI-ProteinID: NP_036047
MGI: 894687
Ensembl: ENSMUSG00000027433
Vega: OTTMUSG00000015692
UniProt: Q9DBR1
Position
2; 2 G2
AA seq 951 aa
MGVPAFFRWLSRKYPSIIVNCVEEKPKECNGVKIPVDASKPNPNDVEFDNLYLDMNGIIH
PCTHPEDKPAPKNEDEMMVAIFEYIDRLFNIVRPRRLLYMAIDGVAPRAKMNQQRSRRFR
ASKEGMEAAVEKQRVREEILAKGGFLPPEEIKERFDSNCITPGTEFMDNLAKCLRYYIAD
RLNNDPGWKNLTVILSDASAPGEGEHKIMDYIRRQRAQPNHDPNTHHCLCGADADLIMLG
LATHEPNFTIIREEFKPNKPKPCALCNQFGHEVKDCEGLPREKKGKHDELADSLPCAEGE
FIFLRLNVLREYLERELTMASLPFPFDVERSIDDWVFMCFFVGNDFLPHLPSLEIREGAI
DRLVNIYKNVVHKTGGYLTESGYVNLQRVQMIMLAVGEVEDSIFKKRKDDEDSFRRRQKE
KRKRMKRDQPAFTPSGILTPHALGSRNSPGCQVASNPRQAAYEMRMQRNSSPSISPNTSF
ASDGSPSPLGGIKRKAEDSDSEPEPEDNVRLWEAGWKQRYYKNKFDVDAADEKFRRKVVQ
SYVEGLCWVLRYYYQGCASWKWYYPFHYAPFASDFEGIADMSSEFEKGTKPFKPLEQLMG
VFPAASGNFLPPTWRKLMSDPDSSIIDFYPEDFAIDLNGKKYAWQGVALLPFVDERRLRA
ALEEVYPDLTPEENRRNSLGGDVLFVGKLHPLRDFILELYQTGSTEPVDVPPELCHGIQG
TFSLDEEAILPDQTVCSPVPMLRDLTQNTAVSINFKDPQFAEDYVFKAAMLPGARKPATV
LKPGDWEKSSNGRQWKPQLGFNRDRRPVHLDQAAFRTLGHVTPRGSGTSVYTNTALPPAN
YQGNNYRPLLRGQAQIPKLMSNMRPQDSWRGPPPLFQQHRFERSVGAEPLLPWNRMIQNQ
NAAFQPNQYQMLGGPGGYPPRRDDHRGGRQGYPREGRKYPLPPPSGRYSWN
NT seq 2856 nt   +upstreamnt  +downstreamnt
atgggagtcccggcgttcttccgctggctcagccgcaagtacccgtccatcattgtcaac
tgcgtggaggagaagccaaaagaatgcaacggtgtaaagattccagttgatgccagtaaa
cctaatccaaatgatgtggagtttgataatctgtatttggatatgaatgggatcatccac
ccctgcactcatcctgaagacaaaccagcaccaaaaaatgaagatgaaatgatggttgca
atttttgagtacattgacagacttttcaatattgtaagaccaagaagacttctctacatg
gcaatagatggggtggcaccacgtgcaaaaatgaatcagcagcgttcaaggaggttcaga
gcatcaaaggaaggaatggaagcagcagttgagaagcagcgagtcagagaggaaatactt
gcaaaaggtggctttcttcctccagaagaaataaaagaaagatttgacagcaactgtatt
accccaggaactgagttcatggacaatcttgctaaatgccttcgctattacatagctgat
cgtttaaataatgaccctgggtggaaaaatttgacagttatattatctgatgctagtgca
cctggtgaaggagaacacaaaatcatggattacattagaagacaaagagcccagcctaac
catgacccaaatactcatcattgtttgtgtggagctgatgctgatctaattatgcttggt
cttgctacacatgaacctaacttcaccataatcagagaagaattcaaaccaaataaacct
aaaccatgtgctctttgtaatcagtttggacacgaggtcaaggattgtgaaggtttgcca
agagaaaagaagggaaagcatgatgaacttgcagatagtcttccttgtgcagaaggggag
tttatcttccttcggctgaatgtccttcgagagtatctggaaagagaactcaccatggcc
agcttaccattcccatttgatgtggagaggagcattgatgactgggtgttcatgtgcttc
tttgtggggaatgatttccttcctcacttgccatcactagagattagggaaggtgcaatt
gatcgtttggttaacatatacaaaaacgtggtacacaaaactgggggttaccttacagaa
agtggttatgtcaatctgcaaagagtacagatgatcatgttagcagttggtgaagttgag
gatagcatttttaaaaagagaaaagatgatgaggacagttttagaagacgacagaaagaa
aaaagaaagaggatgaagagagatcaaccagcttttactcctagtggaatattaacacct
catgccttgggttcaagaaattcaccaggttgtcaagtagccagtaatccaagacaagca
gcctatgaaatgaggatgcagagaaactctagtccttcaatatctcctaatacaagtttt
gcatctgatggctccccatctccactaggaggaattaagagaaaagcagaagacagtgac
agtgagccagagccagaggataacgtcaggttatgggaagctggttggaagcaacgatac
tacaagaacaaatttgatgtagatgcagctgatgagaaattccgacgtaaggttgttcag
tcctacgttgaaggactgtgctgggttcttcgctattattaccagggctgtgcttcctgg
aagtggtattatccattccattatgcaccatttgcctcagactttgaaggtattgcagac
atgtcctctgaatttgaaaagggcacaaaaccgtttaagccactggaacaactaatgggg
gttttcccagctgcaagtggtaactttctacctccaacatggcggaagctcatgagtgac
cctgattccagtataattgacttctatcctgaagattttgctattgatttgaatgggaag
aaatatgcatggcaaggtgttgctctattgccatttgtggatgagcgaaggctgcgagcg
gctctagaagaggtgtacccagacctcactccagaagagaacaggagaaatagtcttgga
ggtgatgttttgtttgtgggaaaacttcatccactacgcgacttcattttagagctgtat
cagacgggttccacagagccagttgatgtgccacctgaattgtgtcacgggattcaaggg
acgttttctttggatgaagaagccattcttccagaccaaacagtatgttcccctgtgccc
atgttgcgggacctgacacagaacactgcagtcagtattaattttaaagatccacagttt
gctgaagattatgtttttaaagctgcaatgcttccaggagcaagaaagccagcaacagtt
ctgaaacctggtgactgggaaaaatccagcaatgggcggcaatggaaacctcagcttggc
tttaaccgggaccggcggcctgttcacctggaccaggcagcctttagaactttaggccat
gttacaccaagaggctcggggacgagtgtttatacgaacactgcactaccacctgccaat
taccaggggaacaattacaggccactgctgagaggtcaagctcagatcccaaaacttatg
tcaaatatgaggccccaagattcctggcgaggccctcctcctcttttccagcagcataga
tttgagagaagtgttggagctgaacctctactgccatggaaccggatgatccaaaaccaa
aatgcagcctttcagccaaatcagtaccagatgctaggaggacctggaggctatccaccc
agacgtgacgatcaccgaggagggagacagggatatcccagagaaggacggaaataccct
ttgccaccaccctcgggaagatacagttggaattag

DBGET integrated database retrieval system