KEGG   Mus musculus (house mouse): 24132
Entry
24132             CDS       T01002                                 
Symbol
Zfp53, D030067O06Rik, KRAZ1, Zfp-53, Zfp118, zfas8
Name
(RefSeq) zinc finger protein 53
  KO
K09228  KRAB domain-containing zinc finger protein
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    24132 (Zfp53)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    24132 (Zfp53)
Transcription factors [BR:mmu03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 others
    24132 (Zfp53)
SSDB
Motif
Pfam: zf-H2C2_2 zf-C2H2 zf-C2H2_4 KRAB zf-C2H2_6 zf-C2H2_jaz Zn-ribbon_8 zf-H2C2_5 zf-met DUF5795 zf_UBZ Raffinose_syn BolA
Other DBs
NCBI-GeneID: 24132
NCBI-ProteinID: NP_038871
MGI: 99200
Ensembl: ENSMUSG00000057409
UniProt: Q9Z117
Position
17:21709179..21742899
AA seq 652 aa
MEQNKETWKMERQEAVAKDPGPQASYSLFFKEKIKEETQKEMAGSPLIMSQRLLTFGDVA
VEFPQEEWECLDSAQRALYIDVMLENYSNLVSVENYCISDTVHQHVKTEKESCQGNELGE
MLHEPTNCALYIRRDTIETSNNYRCSKDRDGSVDLLNQDRHKSTHTGEELCKSEDCEKSL
SLSSNLTENQRLYAANKLQSQGEYDDDFSSVYSLMQQTIYIGDTPHQCEKCRKCFSTASS
LTVHKRIHTGKKPYKCSVCGKSFTQCTNLKTHQRLHTGEKPYKCKECGKSFPQLSALKSH
QKIHTGERPYKCKECDKSFAHCSSFRRHQKTHRAEEHCSCPECGKVLHQLSHLRSHYRLH
TGEKPYKCNECDRSFTYYASYRRHQKTHSLDKFYKCKECGKSFLELSHLKRHYRIHTGEK
PYKCEVCDKSFTVNSTLKTHLKIHTGEKPFKCRECDKSFTKCSHLRRHQSVHTGEKPYRC
KECDKSFTECSTLRAHQKIHTGEKPYKCRECDKSFIQRSNLIIHQRVHTGERPYICKECG
KSFTKCSTLQIHQKIHTGEKPYKCMECNKSFTQDSHLRTHQRVHTGERPYICKECGKSFT
RCSYLRAHQKIHTGEKPYKCKDCDISFIQISNLRRHQRVHTGEKNTIATIVT
NT seq 1959 nt   +upstreamnt  +downstreamnt
atggagcagaacaaagagacctggaagatggagagacaggaggcagtagctaaggatcca
ggaccacaagccagctattcattattcttcaaagagaaaatcaaagaagagacccagaaa
gaaatggctggttctccattaatcatgtcacagcgtctgttgacatttggggatgtggct
gtggaattcccccaggaggagtgggaatgcctggactctgctcagagggctttgtacatt
gatgtgatgttggagaattacagtaacctggtctctgtggagaactactgcataagtgat
actgtccatcaacatgtgaagactgaaaaggagtcttgtcagggtaatgagcttggtgaa
atgcttcatgaacccaccaactgtgcactttatataagacgtgacactatagaaacctct
aataactacagatgctctaaggacagggatggctctgttgacttgttaaatcaagataga
cataaaagcacacacactggcgaagaactttgcaaatctgaagactgtgagaaatcttta
agtttgtcttccaaccttactgaaaatcagagactctatgctgcaaacaaactgcaaagt
cagggagaatatgatgatgatttcagctctgtgtacagtctcatgcaacaaacaatctac
attggagatacaccacaccaatgtgagaaatgcaggaaatgcttcagtaccgcttcaagc
ttaactgtacacaagagaattcatactggaaagaaaccctacaagtgcagtgtttgtggc
aaatcctttacccagtgcacaaatcttaaaacacatcaaagacttcatactggggagaag
ccttacaaatgcaaagagtgtggaaaatcatttcctcagttgtcagcacttaaaagccat
cagaaaattcatactggagagagaccttacaaatgtaaggagtgtgacaaatcctttgcc
cactgttccagtttcaggagacatcagaaaacccatagggctgaggaacattgtagttgt
ccagagtgtggcaaagtcttacatcagctttcacaccttagaagccattacagactccat
actggagagaagccctacaaatgcaatgagtgtgacagatcatttacctactatgcatca
tatagaaggcatcagaaaactcattctctagataaattttacaaatgcaaagaatgtggt
aagtcctttcttgaattatcacatcttaaaaggcattatagaattcatactggtgaaaag
ccttacaaatgtgaggtgtgtgataaatcttttactgttaattctactcttaaaacacat
ctgaaaattcatactggagagaaaccttttaaatgtagggaatgtgataaatcttttacc
aagtgctcacatcttcgaagacatcagagtgttcatactggtgagaaaccttatagatgt
aaggaatgtgacaaatcttttactgagtgttcaactcttagagcccatcagaaaatccat
actggtgagaaaccttacaaatgtagagaatgtgacaaatcctttatccagcgttcaaat
cttataatacatcagagagttcatacgggagagagaccttacatatgtaaggaatgtggc
aaatcttttactaagtgttcaactcttcaaatacatcagaaaattcatactggagagaaa
ccttacaaatgtatggaatgcaacaaatcctttacccaggactcacatcttagaacacat
cagagagttcatactggagagagaccttacatatgtaaggaatgtggcaaatcttttact
cgatgctcatatcttagagcacatcagaaaattcatactggagagaaaccttacaaatgc
aaagactgtgacatatcctttatccagatttcaaatctgagaagacatcagagagttcat
actggagaaaaaaataccattgcaactattgtgacatag

DBGET integrated database retrieval system