KEGG   Mus musculus (mouse): 241489Help
Entry
241489            CDS       T01002                                 

Gene name
Pde11a, 6330414F14Rik, A630086N24Rik, Gm350, PDE11A1
Definition
(RefSeq) phosphodiesterase 11A
  KO
K13298  dual 3',5'-cyclic-AMP and -GMP phosphodiesterase 11 [EC:3.1.4.17 3.1.4.35]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00230  Purine metabolism
mmu04934  Cushing syndrome
mmu05032  Morphine addiction
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    241489 (Pde11a)
 09160 Human Diseases
  09165 Substance dependence
   05032 Morphine addiction
    241489 (Pde11a)
  09167 Endocrine and metabolic diseases
   04934 Cushing syndrome
    241489 (Pde11a)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.17  3',5'-cyclic-nucleotide phosphodiesterase
     241489 (Pde11a)
    3.1.4.35  3',5'-cyclic-GMP phosphodiesterase
     241489 (Pde11a)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PDEase_I GAF GAF_2 GAF_3 HD
Motif
Other DBs
NCBI-GeneID: 241489
NCBI-ProteinID: NP_001074502
MGI: 3036251
Ensembl: ENSMUSG00000075270
Vega: OTTMUSG00000015170
UniProt: P0C1Q2
Position
2; 2 C3
AA seq 933 aa AA seqDB search
MAASRLDFGEVETFLDRHPELFEDYLMRKGKQELVDKWLQRHTSGQGASSLRPALAGASS
LAQSNAKGSPGIGGGAGPQGSAHSHPTPGGGESAGVPLSPSWASGSRGDGSLQRRASQKE
LRKSFARSKAIHVNRTYDEQVTSRAQEPLSSVRRRALLRKASSLPPTTAHILSALLESRV
NLPQYPPTAIDYKCHLKKHNERQFFLELVKDISNDLDLTSLSYKILIFVCLMVDADRCSL
FLVEGAAAGKKTLVSKFFDVHAGTPLLPCSSTENSNEVQVPWGKGIIGYVGEHGETVNIP
DAYQDRRFNDEIDKLTGYKTKSLLCMPIRNSDGEIIGVAQAINKVPEGAPFTEDDEKVMQ
MYLPFCGIAISNAQLFAASRKEYERSRALLEVVNDLFEEQTDLEKIVKKIMHRAQTLLKC
ERCSVLLLEDIESPVVKFTKSFELMSPKCSADAENSFKESVEKSSYSDWLINNSIAELVA
STGLPVNVSDAYQDPRFDAEADQISGFHIRSVLCVPIWNSNHQIIGVAQVLNRLDGKPFD
DADQRLFEAFVIFCGLGINNTIMYDQVKKSWAKQSVALDVLSYHATCSKAEVDKFKAANI
PLVSELAIDDIHFDDFSLDVDAMITAALRMFMELGMVQKFKIDYETLCRWLLTVRKNYRM
VLYHNWRHAFNVCQLMFAMLTTAGFQEILTEVEILAVIVGCLCHDLDHRGTNNAFQAKSD
SALAQLYGTSATLEHHHFNHAVMILQSEGHNIFANLSSKEYSDLMQLLKQSILATDLTLY
FERRTEFFELVRKGDYDWSITSHRDVFRSMLMTACDLGAVTKPWEISRQVAELVTSEFFE
QGDRERSELKLTPSAIFDRNRKDELPRLQLEWIDSICMPLYQALVKVNAKLKPMLDSVAA
NRRKWEELHQKRLQVSAASPDPASPMVAGEDRL
NT seq 2802 nt NT seq  +upstreamnt  +downstreamnt
atggcagcctcccgcctggacttcggggaggtggaaactttcctggataggcacccagag
ttgtttgaagattacttgatgcgaaaaggaaaacaggaactggtggacaagtggctacaa
aggcacacttctggacagggggcttcaagcctgaggcctgccctggctggcgctagcagc
ttggctcagagcaatgctaaaggcagccctggcataggtggtggtgctggaccccagggc
tctgcccacagccatcccacgcccggtggtggggaaagtgctggggttcccttgagtccc
agttgggccagtggcagccggggtgatggcagcctgcagcggagagcttcgcagaaagag
ctgaggaagagctttgcccgctccaaagccatccatgtgaacaggacctacgatgaacag
gtgacctcccgggcccaggagcccctgagcagtgtccggaggagagccctgctcagaaag
gccagctctctgccccccaccacagctcacattctaagtgccctgctggaatcgagggtg
aatctgcctcagtatccccctacggccatcgactacaaatgccacctcaaaaagcataac
gagcgccagtttttcctggaactggtcaaggacatctccaatgaccttgacctcaccagc
ctaagctacaagatcctcatctttgtctgtctcatggtggacgctgaccgttgctctctc
ttcttagtggaaggggcagctgctggcaagaagacgttggtctccaagttttttgatgtg
cacgcaggaaccccactgctcccctgcagtagcacagagaactcaaatgaggtgcaagtc
ccctggggcaaaggtatcattggctatgtcggggaacacggagaaactgttaacatcccg
gatgcctaccaggaccgaagattcaatgatgaaattgacaagctgactggatacaagaca
aaatcactattgtgcatgcccattcggaacagcgacggggagattatcggtgtggcccag
gcgataaataaggtccctgagggtgctccatttacagaagatgacgaaaaagttatgcaa
atgtatcttccgttctgtggaatcgccatatctaatgctcagctcttcgctgcctcaagg
aaagaatacgaaagaagcagggccctgctggaggtggtcaatgacctctttgaagaacag
actgatctggaaaagattgtcaagaaaataatgcatcgggcccaaactctgctgaaatgt
gaacgctgttccgtcttacttctagaagacattgagtccccagtggtgaagtttaccaaa
tcctttgaactgatgtccccaaagtgcagcgctgatgctgagaacagtttcaaagagagt
gtggagaaatcgtcttactctgactggctgataaacaacagcatcgctgagctggttgct
tcgacaggccttcctgtgaatgtcagcgatgcctaccaggacccacgctttgacgctgag
gctgaccagatatctggttttcatataagatctgttctctgtgtccccatttggaacagc
aaccaccaaataattggggtggctcaagtgttgaacagactcgacggaaaaccttttgat
gatgcagaccaaaggctttttgaggcctttgtcatcttttgtggccttggtattaacaac
acaattatgtacgatcaagtgaagaagtcctgggccaagcagtctgtggcccttgatgtg
ctgtcgtaccacgccacgtgttccaaggctgaagtcgacaagtttaaggcagccaacatc
cctctggtgtcggaactggccatcgatgacatccatttcgatgacttttcccttgatgtt
gatgccatgatcacagccgctctacggatgttcatggagctggggatggtacagaaattt
aaaatcgactatgagaccctgtgcaggtggcttctgacggtaaggaaaaactatcggatg
gttctctaccacaactggagacatgccttcaacgtgtgccaactgatgtttgccatgcta
actactgctgggttccaagagattctgaccgaggtggaaattttagcggtgattgtggga
tgcctgtgtcatgacctcgaccacaggggaaccaacaatgccttccaagctaagagtgac
tctgcactggcccagctctacgggacctcggcgaccttggagcatcaccattttaaccat
gctgtgatgatccttcagagtgagggtcacaacatctttgctaatttgtcctccaaggaa
tacagtgacctcatgcagctcctgaagcagtcaatattagccacagacctcacgctctac
tttgagagaagaactgagttcttcgagcttgtcaggaaaggagactacgattggagcatc
acaagccaccgagatgtgttccgatcaatgttaatgacagcctgtgaccttggagccgtg
accaaaccgtgggagatctccagacaggtggctgaacttgtaaccagcgagttctttgaa
caaggagatcgggagaggtcggaactcaagctcactccctctgctatttttgaccggaac
cggaaagatgaactgcctcggttgcagctggagtggattgatagcatctgcatgcctttg
tatcaggccttggtgaaggtcaatgcaaaactgaaaccaatgctggattcagtggctgcc
aaccgaaggaagtgggaagagttgcaccaaaaaagactacaggtctcggctgcctcccca
gaccctgccagtcccatggtggccggggaagacagactgtaa

DBGET integrated database retrieval system