KEGG   Mus musculus (mouse): 241528
Entry
241528            CDS       T01002                                 

Gene name
Lrrc55, A330097E02Rik, Gm351
Definition
(RefSeq) leucine rich repeat containing 55
Organism
mmu  Mus musculus (mouse)
Motif
Pfam: LRR_8 LRR_4 LRR_1 LRRNT LRRCT SieB
Other DBs
NCBI-GeneID: 241528
NCBI-ProteinID: NP_001028518
MGI: 2685197
Ensembl: ENSMUSG00000075224
UniProt: Q3UY51 A0A3B2WBQ3
Position
2; 2 D
AA seq 298 aa
MGDTWAQLPWPGPPHSALLLVFFLLAAGVMHSDAGTSCPVLCTCRNQVVDCSNQRLFSVP
PDLPMDTRNLSLAHNRIAAVPPGYLTCYMELRVLDLRNNSLMELPPGLFLHAKRLAHLDL
SYNNLSHVPADMFREAHGLVHIDLSHNPWLRRVHPQAFQGLVHLRDLDLSYGGLAFLSLE
ALEGLPGLVTLQIGGNPWVCGCTMEPLLKWLRNRIQRCTADSQLAECRGPPEVEGAPLFS
LTEESFKACHLTLTLDDYLFIAFVGFVVSIASVATNFLLGITANCCHRWSKANEEEEI
NT seq 897 nt   +upstreamnt  +downstreamnt
atgggtgacacctgggcccaacttccctggcctgggcctccccactcagccttgttgctg
gtcttcttcctcttggcagctggggtgatgcactctgatgcgggtaccagttgcccagtc
ctttgtacatgtcgtaaccaagtagtggactgcagcaaccagcggctgttctctgtaccc
ccggacctgccaatggacacccgcaacctcagcctagcccacaatcgcattgcagctgta
ccgccaggctatctcacatgctacatggaactccgcgtgctggatttgcgaaacaactcc
ttgatggagctgccccctggcctctttctccacgccaagcgcttagcacacctggatcta
agctacaacaacctcagtcatgtgccagctgacatgttccgggaagctcatggactggta
catatcgacctgagccacaacccctggctgcggagggtgcacccccaggccttccagggc
cttgtgcatctcagagacctggacctcagctatggcggcctggcttttctgagccttgaa
gcccttgagggcctcccagggctggtgaccctacagatcgggggtaacccatgggtatgt
ggctgcaccatggagcccttgctgaagtggctgcggaatcggatacagcgctgtacagcg
gattctcagcttgctgagtgtcggggaccccctgaagttgagggtgcccccctcttttca
ctcactgaagagagcttcaaggcctgccacctgactctgaccctggatgattacctcttc
atcgcatttgtgggctttgtggtctccatcgcttctgtagccaccaacttcctcctgggc
atcacggccaactgttgtcaccgttggagcaaggctaatgaagaagaagagatttga

DBGET integrated database retrieval system