KEGG   Mus musculus (house mouse): 241556
Entry
241556            CDS       T01002                                 
Symbol
Tspan18, 2610042G18Rik, 6720430O15, BB226562
Name
(RefSeq) tetraspanin 18
  KO
K17353  tetraspanin-18
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99992 Structural proteins
    241556 (Tspan18)
SSDB
Motif
Pfam: Tetraspanin TMEM61
Other DBs
NCBI-GeneID: 241556
NCBI-ProteinID: NP_899003
MGI: 1917186
Ensembl: ENSMUSG00000027217
UniProt: Q80WR1
Position
2:complement(93032105..93164898)
AA seq 248 aa
MEGDCLSCMKYLMFVFNFFVFLGGACLLGVGIWVLVDPTGFREIVATNPLLTTGAYIVLA
MGGLLFLLGFLGCCGAVRENRCLLLFFFLFILIIFLVELSAAILAFIFREHLTREFFTKE
LTKHYQGDNDTDVFSATWNSVMITFGCCGVNGPEDFKLASVFRLLTLDTEEVPKACCRRE
PQTRDGVVLSREECQLGRNPFINKQGCYTVILNTFETYVYLAGAFAIGVLAIELFLMVFA
MCLFRGIQ
NT seq 747 nt   +upstreamnt  +downstreamnt
atggagggcgactgtctgagctgcatgaagtatctgatgtttgttttcaatttcttcgtt
tttctgggaggcgcttgcctgctaggtgttggcatctgggtcctggtggaccccaccggc
ttccgagaaatcgtggctaccaaccccctgctgaccaccggtgcctacatcgtactggcc
atgggtggtctgctgtttcttctgggcttcctgggctgctgcggggctgtccgagagaac
aggtgtctgctgctatttttcttcctgtttatcctgatcatcttcctggtagagctctca
gcagccatcctggccttcatcttcagagaacacctcacccgagagttcttcaccaaggag
cttaccaagcactaccaaggcgataacgatacggatgttttctctgccacctggaattca
gtcatgatcacatttggctgctgtggggtcaacggacctgaagacttcaagctggcctcc
gtgtttcggctgctgacgctggacactgaggaggtgcccaaggcttgctgtcggagggaa
ccccagactcgagatggagtggtgctgagcagggaggagtgccagctgggacggaatccg
ttcataaacaagcagggctgttatacagtgatcctcaacaccttcgaaacctatgtctac
ctggccggagcctttgccattggagtactggctattgagctcttcctcatggtctttgcc
atgtgcctcttccggggcatccagtag

DBGET integrated database retrieval system