KEGG   Mus musculus (mouse): 241589
Entry
241589            CDS       T01002                                 

Gene name
D430041D05Rik, 9630056G07Rik, G2
Definition
(RefSeq) RIKEN cDNA D430041D05 gene
Organism
mmu  Mus musculus (mouse)
Motif
Pfam: DUF3827
Other DBs
NCBI-GeneID: 241589
NCBI-ProteinID: NP_001355773
MGI: 2181743
Ensembl: ENSMUSG00000068373
Position
2 E2; 2 54.59 cM
AA seq 1415 aa
MALQEAKPQGPSEAEPAAREPRDRLREQGLCGAGGIAARCQGVRSSEARRSEDVLLRRPL
LLGLLLLAALSGHCWADSGTDNLQIHVTPTSESFPLGKLLPISPTWPFLEVKSSSAADRF
KNVLGQPPDNTTLLKLSQTPLPKAHRRTRAHVDFSSSPYQGSGHSASLDLAKDPTETLVQ
TRPEGGREAADMSVETSVSSKGELSATAAATATTTLFLRRSSPAPLSAALTAKGTGSSSS
NLAKSSLTTALAKNVTNKAASGPKVTAGTIHTAFPFTPTYMLARTAHSLSTHTAMQGATG
SVSGLLSTTHLPKKPQAMHTGLPNPTRPDTPRASTPRPLTITAALTSMTASVKATRLPSL
QTGNTDAAFPAVSTAMATTGRMASNLDCQMSHKFLVKTVFFLTQRRIQSSESLKLGVTKG
LTQALRKAFHQNDVSAHVDILEYSHNVTVGYYATKGRLVYLPAVVMDVLGVYGVSNVTAD
LKQHTPNLQSVAVLASPWKPQPAGAFQLKTVLQFVSQSDNIQSCRFAQTMEQRLQKAFQD
AERKVLSTRSNLTVQIVSTSNASQAVTLVYAVGNQSSFLNGTVASSLLSQLSAELVGFYL
TYPPLTIAEPLEYPNLDTSETTRDYWVITVLQGVDNSLVGLHNQSFARVMEQRLAQLFMM
SQQQGRRFKRATTLGSYTVQMVKMQRVPGPKDPAELTYYTLYNGKPLLGTAAAKILSTID
SQRMALTLHHVVLLQADPVVKNPPNNLWIIAAVLAPIAVVTIIIIIITAVLCRKNKNDFK
PDTMINLPQRAKPVQGFDYAKQHLGQQGADEEVIPVTQETVVLPIPVRDTPQERDTAQDG
SAIKTAKSTETRRSRSPSENGSVISNESGKPSSGRRSPQNGMTQQKVTKEESRKRNVTAS
DEEEGAGLFDSAGKAAADPFDTSSGSVQLIAIKPSALPVVHPASDRGQESSAALNGEVNK
ALKQKSDIEHYRNKLRLKAKRKGYYDFPPVEAGKGLAERKMYEKAPKEVEHVLDADPELC
APFAESKNRQQMKNSVYRSRQSLNSPSPGETEMDLLVTRERPRRGIRNSGYDTEPEIIEE
TNVDRVHEPRGYGRARQAKGHSETSTLSSQPSIDEVRQQMHMLLEEAFSLASAGHAGQSR
HQETYGSTQHLPYSEVVTSAPGTMTRPRAGVQWVPTYRPEMYQYSLPRPAYRFSQLPEMV
MGSPPPPVPPRTGPVAVASLRRSTSDIGSKTRMAESTGPEPTQLHDSASFAQVSRGPVSV
TQLDQSALNYSGNTVPAVFAIPAANRPGFTGYFIPTPPSSYRSQAWMSYAGENELPSQWA
DSVPLPGYIEAYPRSRYQQSSPSRLPRQYSQPANLHPSLEQAPVPSAAASQQSLTENEPP
DTPLTNISTAALVKAIREEVAKLAKKQTDMFEFQV
NT seq 4248 nt   +upstreamnt  +downstreamnt
atggctctgcaggaggcgaagccccagggcccgagcgaagctgagccggcagcgcgggag
cccagggaccggctccgggagcaagggctctgcggggcgggcgggatcgccgcgcgttgc
cagggcgtgagaagctccgaggcccgccggtccgaggatgtgctgctgcggcggccgctg
ctgctgggactcttgctgctggctgccctctccgggcactgctgggccgactccgggaca
gacaatctacagatacatgtcactccgacctcagagtcctttccccttgggaaattgtta
ccaatttcaccaacatggcctttcttggaagtcaagtcttcctcagcagcagacagattc
aagaatgtgctgggacagcctcctgacaacacaaccttgctgaagctatcccagacacct
ctgcctaaggcacaccgtaggaccagggcacatgtggacttctcttcatccccttaccaa
ggaagtggacatagcgcctccctggatcttgccaaggaccccactgagactctggtccaa
acaaggcctgaagggggaagagaagcagcggacatgtcagtggaaacctctgtgtcctcc
aaaggagaactgtcagcaactgcagcagccaccgccaccaccacattgtttctgagaaga
tcaagtccagcgccactgtctgcagcactcactgctaagggcactggcagcagcagcagc
aacttagccaagagcagtctgaccactgctctagctaaaaacgtcaccaacaaggcagca
tcaggcccaaaggtgacagcagggaccatccacacagccttcccattcacaccaacctac
atgcttgcccggacagcacacagcctgagcacacacacagccatgcaaggggcaacaggc
tctgtgtccggcctgttgtccacaacacacctccccaagaagccacaagccatgcacact
ggtctccctaatcctaccaggccagacacacccagagcatccacgccccgtccactgaca
atcacagctgcgctgacgtccatgacggcatcagtaaaggccacgaggctgccatcttta
cagacaggaaacacagatgctgcttttccggctgtgtctactgcaatggccacaactggc
agaatggcatccaacttggactgtcagatgtcccacaagttcctagtgaagacagttttc
ttcctaactcagaggagaatacagagcagcgagtccttgaagcttggggtaaccaaaggg
ctcacacaggcattgcggaaggctttccaccagaacgacgtctccgctcacgtggacatt
ctggaatattctcataatgtcacagttggctattatgctaccaaagggaggctggtgtat
ttgcctgctgtggtgatggacgtgctgggcgtgtatggagtcagcaatgtcactgccgac
ctgaagcagcacactcccaacttacagtctgtggcggtgcttgcctccccgtggaagccc
cagcctgcaggtgccttccagctgaagacagtgctgcagtttgtaagccagtcggacaac
atccagtcctgcaggtttgcccagacaatggagcagaggctgcagaaggcattccaggat
gcagagaggaaggtcctcagcaccaggagcaacctaacagttcagatcgtgagcacgtcc
aatgcctcccaagctgtcacactggtgtatgctgtgggcaatcagagctcgttcctcaac
ggcaccgtggccagcagcctccttagccagctctcagctgagctggtaggattctacctc
acctaccctccactcaccattgctgaaccactggaatatcccaacctcgacacatcagaa
acaaccagagactactgggtcatcacagtgctccagggtgtggacaactcactggtgggc
ctgcacaaccagagctttgcccgggtcatggagcagcgcctggctcagctgttcatgatg
tcccagcaacaaggccgacggtttaaacgtgctaccaccttgggaagctacactgtgcag
atggtaaagatgcagcgagtgccaggaccaaaggacccggcagagctgacgtactacaca
ctgtacaacgggaagccactgctggggactgcagcagccaagatcctaagcaccatcgac
tcccagaggatggccctgaccctgcatcacgttgtccttctacaagctgaccccgtggta
aagaatccacccaacaacctgtggatcatcgctgcggtgctggctcccatcgccgtggtc
accatcatcatcatcatcatcactgctgtgctttgtaggaagaacaagaacgacttcaag
ccggacaccatgataaacctgccgcagagagcgaagcccgtgcaaggctttgactacgcc
aagcagcatctcggccagcaaggggcagatgaggaggtcatccctgtgacccaggaaacg
gtggtcctccccatacctgtcagagatactcctcaggaaagagacacggctcaagatggc
agcgccatcaagacggctaagtccactgaaaccagaaggagcaggtcgcccagtgagaat
ggctctgtcatcagcaacgaatcaggaaagcccagctcagggaggcgctcaccccagaat
ggaatgacacagcagaaagtgacaaaggaggagtccagaaagagaaacgtgacagcgagc
gatgaagaggagggagcaggtctctttgacagcgctggcaaggcggcagcagatcccttt
gacacctcttctggatctgtgcagctcatcgctatcaaaccatcagctctgcccgtagtg
caccctgcctccgacaggggacaggagtcctcagcagcgctcaatggcgaggtgaacaag
gctctgaagcagaaatcagacattgagcactaccggaacaagctgcgcctgaaagccaag
aggaaggggtattatgactttcccccagtggaggcaggcaaaggcctggcggaaaggaag
atgtatgagaaagcccccaaggaagtggagcatgttttggacgcagacccagaactgtgt
gctccctttgcggagtctaaaaacaggcaacagatgaagaactctgtctaccgaagccgg
cagtctctgaatagtccgagtccgggagaaactgagatggaccttctggtcacgcgcgag
cgaccccgacgtggaatccggaacagcggatatgatactgagcccgagatcatagaagag
accaacgtggacagagtccacgagccccggggctacggcagggcgcggcaggcgaagggc
cactccgagacctccacactgagctcgcagccttccatcgacgaagtccgacagcagatg
cacatgcttttagaggaagcctttagcctggcatctgctggccatgcaggccagagccgg
caccaggagacctacggctccacccagcacctgccgtactcagaggtggtgaccagtgct
ccggggaccatgacacggcccagggctggggtgcagtgggtgcccacctaccgaccggaa
atgtaccagtacagtctgccccggccggcctacaggttctcccagcttcctgagatggtc
atgggctctcccccgcccccagttccacctcgaacaggccctgtggccgtggcttccctc
aggaggtccacctcagacattggcagcaagacccggatggcggagtccacgggacctgag
cccacccagttgcatgacagtgcctcatttgcccaggtgtccagaggtcccgtgtccgtg
acgcagttggatcagtcggctttaaattactcaggtaacacggtgccagcggtgtttgcc
atcccagctgccaacagacccggcttcaccggctacttcatcccaacaccaccctcatcc
tacaggagccaggcttggatgtcctatgcaggagagaatgagctcccgagccagtgggct
gattcggtccctcttcctgggtacatcgaggcctaccccaggtcacgttatcaacagagc
tccccctccaggctccctcgccagtatagccagccagccaaccttcatcccagcctagag
caggcccctgtcccctctgcagctgcctcacagcaaagcctgaccgaaaatgagcctccg
gacactccgttgaccaacatctccactgcagccctcgtgaaggctatccgagaggaagta
gccaagttggccaagaagcagacagacatgtttgagttccaggtctaa

DBGET integrated database retrieval system