KEGG   Mus musculus (mouse): 241634
Entry
241634            CDS       T01002                                 

Gene name
Spdye4c, Gm355, SpeedyB3, SpyB3
Definition
(RefSeq) speedy/RINGO cell cycle regulator family, member E4C
  KO
K08694  speedy
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04114  Oocyte meiosis
mmu04914  Progesterone-mediated oocyte maturation
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    241634 (Spdye4c)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    241634 (Spdye4c)
SSDB
Motif
Pfam: Spy1
Other DBs
NCBI-GeneID: 241634
NCBI-ProteinID: NP_001297570
MGI: 2685201
Ensembl: ENSMUSG00000074812
Vega: OTTMUSG00000015362
UniProt: I6XKQ3
Position
2; 2 F1
AA seq 339 aa
MSTPVASDTTPRLQKPTKGQKKKVPVKATIASDRRSEMSPVSSKESCKQNDSGKQVPADS
VCLAKKAPQVTSILASSDGSAGDVPEQRSKRKKGQRKRKLDNIKMDPEVCVTLASSDASA
GDVPVQRTKRKRAHKTRTLVDVKAAIQEGSVLASSTATPEAAPGATSKLKFPRRGKKRSI
WAVNRIEGMKLILNKKRRASYRPEDLEAFYRLLEDPVVQNFLAADIFFRVTDKYLLSMVV
EYFGRVGLPGHLYNRIYFFLALYIACDMEEDDPISKRSIFQFLLGRDTWQGLYKDFLKLQ
KDFILAMDYQAWVTPDQCAEIQNQNPQHWVWSRVRQGTP
NT seq 1020 nt   +upstreamnt  +downstreamnt
atgtccacaccagttgcctcagataccacaccacggcttcagaagccaacgaaaggtcaa
aagaaaaaagtgcctgtgaaagcaacgatagcttcagacagaagatccgagatgtcacct
gtctcctcaaaggagtcctgcaagcagaatgattcagggaaacaggtgccagcggacagt
gtttgcttggcaaaaaaagctccacaggtcaccagtattctggcttccagtgatggctct
gcaggggatgtccctgagcagagatccaagaggaaaaagggccaaagaaaaagaaaactg
gacaatatcaagatggatccagaagtctgtgtcactcttgcctccagtgatgcctcggca
ggggatgtccctgtgcagcgaaccaaaaggaagagggctcacaagacaaggacacttgtg
gatgtcaaagcagctatccaagagggcagcgtgctggcctccagcacagccacccctgaa
gctgcccctggagccacctcaaagctcaagttccccaggagggggaagaaaaggagcata
tgggctgtgaaccgtatagaggggatgaaactcatactgaacaagaagagaagagccagc
taccgccctgaggacctcgaagccttctaccgacttctggaggatcctgtggtccagaat
ttcttggcagcggacattttcttcagggtgactgacaagtatctgctgtctatggtggtg
gagtattttggtcgagttgggcttcctggacatctctacaacaggatctacttcttcctg
gccctctatatcgcctgtgacatggaagaggatgaccccatatccaagaggagcatcttc
caattcttgctgggcagagacacctggcaaggcttatacaaggatttcctgaagctgcag
aaggatttcatcctagccatggattaccaagcctgggtcacgccagatcagtgtgcagag
atccagaaccagaacccacagcactgggtctggagtcgggtgcgccagggcaccccttag

KEGG   Mus musculus (mouse): 330228
Entry
330228            CDS       T01002                                 

Gene name
Spdye4b, 4933411G11Rik
Definition
(RefSeq) speedy/RINGO cell cycle regulator family, member E4B
  KO
K08694  speedy
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04114  Oocyte meiosis
mmu04914  Progesterone-mediated oocyte maturation
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    330228 (Spdye4b)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    330228 (Spdye4b)
SSDB
Motif
Pfam: Spy1 X
Other DBs
NCBI-GeneID: 330228
NCBI-ProteinID: NP_001371122
MGI: 3612701
Ensembl: ENSMUSG00000029586
Vega: OTTMUSG00000031824
Position
5; 5 G2
AA seq 246 aa
MVSGERVSSWMVMPWSSPLCTMPSKSAFFSQPRVEATPQPPSSIQKRKRDESSDSEDDLA
ELFEPDPQPVWSVETPCGLRMTLQRQCVSTVRPEHHKVFTKLLEDPVVKKFLTWDKMLRV
SDKYLLSMVIAYFSRAGLFSWQYRPIHFFLALYLANDMEEDNQAPKQDIFYFLYGKSYAQ
RPMFHKLRFQFIRSMGWRIWVSQEECEEIQAYDPELWVWTRDRTKLTQNPRVMDTRGHPP
AIDPCA
NT seq 741 nt   +upstreamnt  +downstreamnt
atggtctcaggagaaagggtaagctcgtggatggtcatgccctggagctcgcctctgtgc
accatgccgtctaaatctgctttcttcagtcaaccaagggtggaagccactccccagcct
ccatccagcatccaaaagaggaagagggacgagtcatcagattctgaggatgacctggca
gagctatttgaacctgatccccagccggtgtggtcagtggagacgccgtgtgggctcagg
atgacgctgcagaggcaatgtgtgtctacagtgaggcctgaacaccacaaggtcttcacc
aagttgctcgaggatcccgtggtgaaaaaattcctgacctgggacaagatgctgcgggtg
tcagacaagtacctcctgtctatggtcatagcttatttcagccgcgctgggctcttctcc
tggcagtacaggcccatccacttcttcctggctctctacctggccaatgacatggaggag
gacaaccaggcccctaagcaagacattttttacttcctctatgggaagagctatgcccag
cgccccatgttccacaaactgcgcttccagttcattcggtccatgggctggaggatctgg
gtgtcccaggaagagtgtgaagagatccaggcttacgacccagagctctgggtatggaca
cgggatcgtactaagctgacccagaaccctagggtcatggatactcgaggccatccgcct
gccatagatccctgtgcctga

KEGG   Mus musculus (mouse): 70891
Entry
70891             CDS       T01002                                 

Gene name
Spdya, 4921517J08Rik, 4930548B21Rik, GS4, MLZ-465, Spd, Spdy1
Definition
(RefSeq) speedy/RINGO cell cycle regulator family, member A
  KO
K08694  speedy
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04114  Oocyte meiosis
mmu04914  Progesterone-mediated oocyte maturation
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    70891 (Spdya)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    70891 (Spdya)
SSDB
Motif
Pfam: Spy1 MCAfunc
Other DBs
NCBI-GeneID: 70891
NCBI-ProteinID: NP_083530
MGI: 1918141
Ensembl: ENSMUSG00000052525
Vega: OTTMUSG00000033091
UniProt: Q5IBH7
Position
17; 17 E1.3
AA seq 310 aa
MRHNQMYCETPPTVTIHVKSGSNRSHQTRKPISLKRPILKDSWEASENNAQNNKSKRPRG
PCLIIQRQEMTAFFKLFDDDLIQDFLWMDCCCKIADKYLLAMTFVYFKRAKFTINEHTRI
NFFIALYLANTVEEDEEEAKYEIFPWALGKNWRKLFPNFLKLRDQLWDRIDYRAIVSRRC
CEEVMAIAPTHYIWQRERSVHHSGAVRNYNRDEVHLPRGPSATPVDCSLCGKKGRYVRLG
LSSSSSSSSDTGELMEKDSQELHSAFSVDTAGDPPHTYSQVANDHQSNKENETNFVKKNK
SVEWFAESEE
NT seq 933 nt   +upstreamnt  +downstreamnt
atgcggcataatcagatgtattgtgagacaccacctactgtcactattcatgtaaaatca
ggctcaaataggtcacatcaaaccagaaaacctattagtctgaaacgtcctattcttaaa
gatagttgggaagcatctgaaaacaatgctcagaataacaaatctaagcggcccagaggg
ccttgtctaatcatacagcgccaggaaatgactgctttctttaaattatttgatgatgat
ttaattcaagatttcttgtggatggactgctgctgcaagattgcagacaagtatcttttg
gctatgacctttgtttatttcaagagagctaaatttactataaatgagcataccaggata
aatttctttattgctctgtatctggctaatacggttgaagaagatgaagaagaagccaag
tatgaaatttttccatgggctttagggaaaaactggagaaaactgttccctaatttctta
aagttaagggaccaactctgggacagaattgactatagggctattgtaagcaggcgatgc
tgtgaagaggtcatggccattgcgccaacccattacatctggcaacgagagcggtctgtg
catcacagtggagctgttaggaactacaacagagatgaggttcacctgcccaggggacct
agtgccacaccagtggattgctcactgtgtggtaaaaaaggaagatacgtgagactggga
ctgtcttcatcctcatcttcctccagtgacacaggagagctaatggaaaaagattctcag
gaactacacagtgcattctcagtggacacggcaggtgaccctcctcatacctattctcaa
gtagccaatgaccatcaatcaaacaaagaaaatgaaactaattttgtgaagaaaaacaaa
tccgtggaatggtttgcagagagtgaagaatga

KEGG   Mus musculus (mouse): 74673
Entry
74673             CDS       T01002                                 

Gene name
Spdye4a, 4930445A17Rik, 4930451F05Rik, RINGO_E4A, Spd, Spdy2, Spdyb, Spdye4, Spy/Ringo_B
Definition
(RefSeq) speedy/RINGO cell cycle regulator family, member E4A
  KO
K08694  speedy
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04114  Oocyte meiosis
mmu04914  Progesterone-mediated oocyte maturation
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    74673 (Spdye4a)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    74673 (Spdye4a)
SSDB
Motif
Pfam: Spy1
Other DBs
NCBI-GeneID: 74673
NCBI-ProteinID: NP_083324
MGI: 1921923
Ensembl: ENSMUSG00000039296
Vega: OTTMUSG00000031883
UniProt: Q5IBH6
Position
5; 5 G2
AA seq 268 aa
MGEGTPGVDSARVQEEGGRDQSLGFVEGRIQVGRIVTAGQLSLCSEEQSPQPGITRPSPG
VVVDGESSGLAEPRVEATPQPPSSIQKRKRDESLDSEDDLAELFEPDPQPVWSVEMLCGL
RMRLKRRRVSTVRPEHHKVFTKLLEDPVVKKFLTWDKMLRVSDKYLLSMVIAYFSRAGLF
SWQYRPIHFFLALYLANDMEEDNQAPKQDIFYFLYGKSYAQRPMFHKLRFQFIRSMGWKI
WVSREECEEIQAYNPDLWVWARDRTNLT
NT seq 807 nt   +upstreamnt  +downstreamnt
atgggggaagggacgccaggcgtggattcagccagagtccaggaggagggcgggagagat
cagagtctgggatttgtggaagggagaatacaggttgggagaatcgtgactgctggccaa
ctgtcattgtgttctgaggaacagagccctcagcctggcatcaccaggccctcacctggg
gtggtggtagatggggagagctcaggactggcagaaccaagggtggaagccactccccag
cctccatccagcatccaaaagaggaagagggacgagtcattagattctgaggatgacctg
gcagagctatttgaacctgatccccagccagtgtggtcagtggagatgctgtgcggactt
aggatgaggctgaagaggcgacgtgtgtctacagtgaggcctgaacaccacaaggtcttc
accaagctgctcgaggatcctgtggtgaaaaaattcctgacctgggacaagatgctgagg
gtgtcagacaagtacctcctgtctatggtcatagcttatttcagccgcgctgggctcttc
tcctggcagtacaggcccatccacttcttcctggctctctacctggccaatgacatggag
gaggacaaccaggcccctaagcaagacattttttacttcctctatgggaagagctatgcc
cagcgccccatgttccacaaactgcgctttcagttcattcggtccatgggctggaagatc
tgggtgtcccgggaggagtgtgaagagatccaggcttacaatccagacctttgggtgtgg
gcacgagatcgcaccaacctgacctag

DBGET integrated database retrieval system