KEGG   Mus musculus (mouse): 241656Help
Entry
241656            CDS       T01002                                 

Gene name
Pak7, 2900083L08Rik, PAK-5, PAK-7, Pak5
Definition
(RefSeq) p21 (RAC1) activated kinase 7
  KO
K05736  p21-activated kinase 5 [EC:2.7.11.1]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04012  ErbB signaling pathway
mmu04014  Ras signaling pathway
mmu04360  Axon guidance
mmu04510  Focal adhesion
mmu04660  T cell receptor signaling pathway
mmu04810  Regulation of actin cytoskeleton
mmu05170  Human immunodeficiency virus 1 infection
mmu05211  Renal cell carcinoma
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    241656 (Pak7)
   04012 ErbB signaling pathway
    241656 (Pak7)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    241656 (Pak7)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    241656 (Pak7)
 09150 Organismal Systems
  09151 Immune system
   04660 T cell receptor signaling pathway
    241656 (Pak7)
  09158 Development and regeneration
   04360 Axon guidance
    241656 (Pak7)
 09160 Human Diseases
  09162 Cancer: specific types
   05211 Renal cell carcinoma
    241656 (Pak7)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    241656 (Pak7)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mmu01001]
    241656 (Pak7)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     241656 (Pak7)
Protein kinases [BR:mmu01001]
 Serine/threonine kinases: STE group
  STE20 family
   241656 (Pak7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr PBD Kinase-like Pkinase_fungal
Motif
Other DBs
NCBI-GeneID: 241656
NCBI-ProteinID: NP_766446
MGI: 1920334
Ensembl: ENSMUSG00000039913
Vega: OTTMUSG00000015988
UniProt: Q8C015
Position
2; 2 F3
AA seq 719 aa AA seqDB search
MFGKKKKKIEISGPSNFEHRVHTGFDPQEQKFTGLPQQWHSLLADTANRPKPMVDPSCIT
PIQLAPMKTIVRGNKSCKETSINGLLEDFDNISVTRSNSLRKESPPTPDQGAASRIQGHS
EENGFITFSQYSSESDTTADYTTEKYRDRSLYGDDLDLYYKSSHAAKQNGHAMKMKHGDA
YYPEMKSLKTDLAGFPVDYHTHLDSLRKSSEYGDLRWDYQRASSSSPLDYSFQLTPSRTA
GTSRCSKESLAYSESDWGPSLDDYDRRPKSSYLHQTSPQPAMRQRSKSGSGLQEPMMPFG
ASAFKTHPQGHSYNSYTYPRLSEPTMCIPKVDYDRAQMVFSPPLSGSDTYPRGPTKLPQS
QSKAGYSSGSHQYPSGYHKASLYHHPSLQTSSQYISTASYLSSLSISSSTYPPPSWGSSS
DQQPSRVSHEQFRAALQLVVSPGDPREYLDNFIKIGEGSTGIVCIATEKHTGKQVAVKKM
DLRKQQRRELLFNEVVIMRDYHHDNVVDMYNSYLVGDELWVVMEFLEGGALTDIVTHTRM
NEEQIATVCLSVLKALSYLHNQGVIHRDIKSDSILLTSDGRIKLSDFGFCAQVSKEVPKR
KSLVGTPYWMAPEVISRLPYGTEVDIWSLGIMVIEMIDGEPPYFNEPPLQAMRRIRDSLP
PRVKDLHKVSSMLRGFLDLMLVREPSQRATAQELLGHPFLKLAGPPSCIVPLMRQYRHH
NT seq 2160 nt NT seq  +upstreamnt  +downstreamnt
atgtttgggaagaaaaagaaaaagatcgaaatatctggcccatccaactttgaacacagg
gttcatactggatttgatccacaagagcagaagtttactggccttccccagcagtggcac
agcctgttagcagacacagccaacaggcccaagcccatggtggacccatcatgcatcaca
cccatacagctggctcccatgaagacaatcgtcagaggaaataaatcctgcaaggaaacc
tctatcaatggtctgctagaggattttgacaacatctccgtgactcgctccaactctcta
aggaaagaaagcccacccaccccagatcagggagcagctagccgcattcaaggccactcg
gaagagaacggcttcatcactttctcacaatattccagtgaatccgatacgactgcggac
tacacaactgaaaagtacagagacaggagtctctatggagatgacctggatctgtactat
aaaagcagccatgcagccaagcaaaatgggcatgccatgaagatgaaacatggagacgct
tactaccctgagatgaagtctttgaaaaccgacctggccggattccctgtcgactatcac
acccacttggactctctgagaaaatcaagtgaatatggtgaccttaggtgggattatcag
agagcctctagtagctcccctctggactactcattccagctcacgccttctagaactgca
gggaccagcaggtgctccaaggagagtctggcatacagtgaaagtgattggggacccagc
ctggatgactatgacaggaggccaaaatcatcatacctgcatcagacgagccctcagcca
gccatgcgccagagatccaagtccggctcagggcttcaggaacccatgatgccatttgga
gcaagtgcatttaaaactcatcctcaaggacactcgtacaactcctacacctaccctcga
ttgtccgagcccacaatgtgcattccaaaggtggattacgatcgagcacagatggtcttc
agtcctccactgtcagggtccgacacttaccccagaggccccaccaaactacctcaaagt
caaagcaaagcaggctactcttcaggcagccaccagtacccttctgggtaccacaaagca
tctctataccaccatccatccctgcaaaccagttctcagtacatctccaccgcttcttac
ttaagctctctcagtatctcctcgagcacctaccctccacctagctggggctcctcctca
gaccagcagccctcaagggtatcccatgaacaattccgagctgccctgcaactggtggtc
agcccaggagaccccagggaatatttggataactttattaaaatcggagaagggtcgaca
ggcatcgtgtgcattgcaacagagaaacacacaggcaagcaagtggcagtgaagaaaatg
gacctccgaaagcagcagagacgggaactcctttttaatgaggtcgtgataatgcgtgat
taccaccatgacaacgtagttgacatgtacaacagctaccttgttggagatgagctctgg
gtggtcatggagtttctagaaggtggtgccttgacagacattgtcactcataccagaatg
aatgaagagcagatagctactgtctgcctgtcagttctgaaagctctgtcctaccttcat
aaccaaggagtgattcacagggacataaagagtgactccattcttctgacaagcgatggc
cggataaagttatctgactttggtttctgtgctcaagtttccaaagaggtgccaaagagg
aagtcactggtgggtaccccatactggatggcacctgaggtgatttccaggctaccttat
gggacagaggtggacatctggtccctcgggataatggtgatagagatgattgatggggag
cccccctatttcaatgagcctcctctgcaggccatgaggaggatccgggacagtttacct
ccaagagtgaaggacctacacaaggtttcttccatgctccgaggattcctagatcttatg
ttggtgagggagccctctcaaagagccacagctcaagaactccttggacatccattctta
aaattggcaggtccaccatcttgcattgttcctctcatgagacaatacagacatcactga

DBGET integrated database retrieval system