KEGG   Mus musculus (mouse): 241688Help
Entry
241688            CDS       T01002                                 

Gene name
Dzank1, 2810039F03Rik, 6330439K17Rik, Ankrd64
Definition
(RefSeq) double zinc ribbon and ankyrin repeat domains 1
Organism
mmu  Mus musculus (mouse)
SSDB OrthologParalogGFIT
Motif
Pfam: DZR Fn3_assoc CHB_HEX_C_1 Ank_2 Ank_4 zinc_ribbon_2 Ank_5 zf-RanBP zf-C4H2 PknG_rubred
Motif
Other DBs
NCBI-GeneID: 241688
NCBI-ProteinID: NP_766447
MGI: 2139080
Ensembl: ENSMUSG00000037259
Vega: OTTMUSG00000004235
UniProt: Q8C008
Position
2; 2 G1
AA seq 778 aa AA seqDB search
MTAGSVCAPQIIPLRVPQPGKANHEIDTNTLLEMKSDTPDVNIYYTLDGSKPDFLKKVGS
GENNTFKYVKPITLPDGKIQVKAVAVSKDCRQSGIVTKVFQVDYEPPKMVSSEDNVEDAL
KGFSKQELKNGFVGPKLRKKYKNAENKSTWNVNLRRLADLKVGERADPKTLKDLRFAESP
LEIPAYHEGASARLPTHQAQSPGFAHITGQKSLTSTEIMRIQRETDFLKCAHCLASRPSD
PFARFCHECGAPVPPIFGYRLPPPEGAQMGLCAECGSMVPMNTPICVVCEAPLAPQLRPQ
ASLYLKERVICRTCGTGNPAHLRYCVTCEGPLPPTQEQWLCNGDEVPHPPARNGETISCS
RCGCQNLWEASFCDWCGAMLGISASHSVCPKCGASNHLTARFCGSCGIYVKSITRFRMHN
SLAIVAGAPRPFPEPRSAWQSLNVPLPTSASGSKKDTGTQTSGLFYPSGKLLAKKELEAA
SHRQRQEKMSDHRPVLTAVSPGRGYWRKQLDHISAHLRSYAQNNPEFRALIAEPRMGKLI
SATVHEDGYEVSIRLNYIQVSNKSLYFNKSVNLSDHFLSSVTEGGNGLYDSRSSLVSAYS
QSVSDTPESIKKMKNLKAKSFLVNPEPLTPENKLLLEEVGSSGKGRLSVLEQLLDEGADP
NCCDSQGRPAVIVAVVNKHYEAIPVLAQRGADIDQQWGPFRNTALHEATLLGLEGRESIA
TLLGCNANAQKKNTRGQTAYDIALEMGDDLTSSLFAAKFTQGLEDQLSPPGNRILGDS
NT seq 2337 nt NT seq  +upstreamnt  +downstreamnt
atgactgctggctcagtgtgtgcccctcagatcataccactgcgagtgcctcaacctgga
aaagctaaccatgaaattgataccaatactcttttggaaatgaaatccgacaccccagat
gtcaacatatattacaccctggatggcagcaaacctgacttcctaaagaaagttggttct
ggtgaaaataatacatttaaatatgtaaaacctattactctgcctgatggaaaaattcaa
gttaaagctgttgctgtctctaaagactgcagacagagtggaattgtgacaaaggtgttt
caggtggactatgaaccaccgaagatggtctcttctgaagacaatgttgaagatgctctc
aaggggttctcaaagcaggaattaaaaaatgggtttgtcggaccaaaactaaggaagaag
tataagaatgctgaaaataaatcaacttggaacgttaaccttagacggcttgcagacctc
aaggtaggcgaaagagcagaccctaaaactctgaaagatcttcgcttcgcagagagtcca
ctggaaatcccagcctaccatgagggagcgagtgctcgactgcctactcaccaggcccag
tcccctggctttgcacacataactggccagaagagtctgacgagcaccgagatcatgagg
atccagagggagacagacttcctcaagtgtgcccactgtctggcttcccgtccatctgat
ccatttgctcgcttctgtcacgaatgtggagctcctgtcccacccatatttggctatcgt
cttccacccccagaaggggctcagatgggcctgtgtgcagaatgtggcagtatggttccc
atgaacacccccatctgtgtggtgtgcgaagctcctcttgctccacagcttcggccacag
gccagcctctacttaaaggagagggtaatctgtcgcacctgtggcactgggaatcctgct
catctgagatactgtgtcacctgtgagggacccctgcctccaacacaagagcagtggctg
tgcaatggagatgaagtccctcatccgcccgctcgaaatggggagaccatttcctgctcc
aggtgtggctgccagaacctctgggaggcatccttctgtgactggtgtggagccatgctt
ggcatttctgctagccactctgtctgcccaaaatgtggggccagcaatcatctgactgcc
cgcttctgtggctcctgtggtatttatgtgaagtccataacaaggtttagaatgcataac
agcttggccatagttgctggagcgcctcgcccatttcctgagccccgatctgcctggcag
tccctaaacgtccctttgcccacatctgccagtgggtctaagaaggacacgggcactcag
acctctggcctgttctacccatctggcaagctcctggcaaagaaggaactggaggcggct
tctcacaggcagaggcaggagaagatgagtgaccacaggccagtcctcacagccgtcagc
ccgggaagaggctactggagaaagcagttggatcacatctctgctcacctcaggtcctat
gctcagaacaaccctgaattccgggccttgattgcagagcccaggatggggaagcttatc
tctgccactgtccatgaagatggctatgaagttagcatcagactgaactatattcaagtc
tcaaacaagagcctgtacttcaacaagtcggtgaatctcagtgaccactttctgagcagt
gtcaccgaaggtgggaacgggctatatgacagcaggtccagcttggtgagtgcctatagc
cagagcgtctcagacacccccgaaagtatcaagaagatgaagaatctcaaggccaaaagc
ttccttgtgaacccagagccgctcacacctgaaaacaaactcctgctggaggaagttggc
tcctcagggaaaggaagactgtctgtgctggaacagctgctggatgaaggagcagaccct
aactgctgtgatagtcaaggtcgacctgctgttattgtggctgttgtgaataaacactat
gaagccattccagtcctcgctcagagaggagcagacatcgaccagcagtggggaccgttc
agaaacacagctcttcacgaagcaactctacttggcctggaaggaagggagagcatcgcc
actttactgggatgcaatgcaaacgcccaaaagaagaacacaagaggccagacagcatat
gacatcgctctggagatgggagatgacctcacctcttctctctttgccgctaagttcacc
caaggtctggaggaccaactttctccacctgggaaccgcatcctaggtgacagttag

DBGET integrated database retrieval system