KEGG   Mus musculus (mouse): 241794
Entry
241794            CDS       T01002                                 

Gene name
Kcng1, AW536275
Definition
(RefSeq) potassium voltage-gated channel, subfamily G, member 1
  KO
K04900  potassium voltage-gated channel subfamily G member 1
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:mmu04040]
    241794 (Kcng1)
Ion channels [BR:mmu04040]
 Voltage-gated cation channels
  Potassium channel, voltage-gated (Kv)
   241794 (Kcng1)
SSDB
Motif
Pfam: Ion_trans BTB_2 Ion_trans_2
Other DBs
NCBI-GeneID: 241794
NCBI-ProteinID: NP_001074603
MGI: 3616086
Ensembl: ENSMUSG00000074575
Vega: OTTMUSG00000016048
UniProt: A2BDX4 B2RVK9
Position
2; 2 H3
AA seq 514 aa
MTLLPGDNSHYDYSALSCASDTSFHPAFFPQRQAIKGVFYRRAQRLRPQDDLHQSCSLGD
RRRQIIINVGGIKYSLPWTTLDEFPLTRLGQLKACTNFDDILSVCDDYDVTCNEFFFDRN
PGAFGTILTFLRAGKLRLLREMCALSFQEELLYWGIAEDHLDGCCKRRYLQKIEEFAEMM
EREEEEEPLDSEDQESEGPSASEGRLSRCMRRLRDMVERPHSGLPGKVFACLSVLFVTVT
AVNLSVSTLPSLREEEEQGQCSQMCHNVFIVESVCVGWFSLEFLLRFIQAPSKFAFLRSP
LTLIDLVAILPYYVTLLVDGAASSRRKPSTGNSYLDKVGLVLRVLRALRILYVMRLARHS
LGLQTLGLTARRCTREFGLLLLFLCVAIALFAPLLYVIENEMADSPEFTSIPACYWWAVI
TMTTVGYGDMVPRSTPGQVVALSSILSGILLMAFPVTSIFHTFSRSYLELKQEQERVLIR
RAQYLIKTKSQLSGMSQDSDILFGSASSDTRDNN
NT seq 1545 nt   +upstreamnt  +downstreamnt
atgaccctgttaccgggagacaactcgcactatgactacagcgctctaagctgcgcctca
gacacctccttccacccggccttcttcccacagcgccaggccatcaagggcgtcttctac
cgcagggcccaacgattgcggccgcaggacgacctgcaccagagctgctcccttggggac
cgcaggcgacagatcatcatcaacgtgggtggcatcaagtactcactaccttggaccacc
ctggatgagttcccactgacgcggctgggccagctcaaggcctgcaccaacttcgacgac
atcctgagcgtgtgtgatgactatgacgtaacctgcaacgagttcttcttcgaccgcaac
cccggagcttttggcaccatcctcaccttcctgcgggccggcaagctgaggctgcttcgg
gagatgtgcgccctgtccttccaggaggagctgctgtactggggcatcgcggaggaccac
ctggacggctgctgcaagcgccggtacctgcagaaaatcgaggagtttgctgagatgatg
gagcgcgaggaggaggaggagccgctggacagcgaggatcaagagagtgagggtccgtcc
gccagcgagggccgcctgagccgctgcatgaggaggctgcgtgacatggtggagcggcca
cactcagggctgcctggcaaggtgtttgcctgcctgtccgttctgtttgtcaccgtcacc
gccgtcaacctgtctgtcagcaccctgcccagcctgcgtgaggaggaggaacagggccag
tgttcccagatgtgccacaacgtcttcatcgtcgagtcggtgtgcgtgggctggttctcc
ctagagttcctgctgcgcttcatccaggcacccagcaagttcgccttcctgcggagtccg
ctgaccctcatcgacctggtggccatcctgccttactatgtcacactgctggtggatggc
gctgcctccagccgccgcaagccgagcaccggcaacagctacctggacaaggttgggcta
gtgctgcgcgtgctgcgggcgctgcgcatcctctacgtgatgcgtctggcccggcattca
ctggggctgcagacactgggcctcacggcacggcgctgcacgcgtgaattcgggcttctg
ctgcttttcctgtgtgtggccatcgccctctttgccccactgctctatgtcatcgagaat
gagatggcagacagccccgaattcaccagcatccccgcctgctactggtgggctgtcatc
accatgacaaccgtaggctacggagacatggtaccccggagcacaccgggtcaggtggtg
gctctgagcagcatcctcagtggcatcctcctcatggccttccctgtcacctccatcttc
catactttctcccgctcttacctggagctcaagcaggaacaagaacgggtgctgatccgc
cgggctcagtacctcatcaaaaccaagtcacagctcagtggcatgtcccaggacagtgac
atcttgtttggaagtgcctcttcagacactagggacaacaactga

DBGET integrated database retrieval system