KEGG   Mus musculus (mouse): 242022
Entry
242022            CDS       T01002                                 

Gene name
Frem2, 6030440P17Rik, 8430406N05Rik, Gm409, b2b1562C, b2b1562Clo, my, n, ne, nv1
Definition
(RefSeq) Fras1 related extracellular matrix protein 2
  KO
K23380  FRAS1-related extracelluar matrix protein 1/2
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04512  ECM-receptor interaction
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    242022 (Frem2)
SSDB
Motif
Pfam: Cadherin_3 Calx-beta Big_9 Cadherin_4
Other DBs
NCBI-GeneID: 242022
NCBI-ProteinID: NP_766450
MGI: 2444465
Ensembl: ENSMUSG00000037016
Vega: OTTMUSG00000053495
UniProt: Q6NVD0
Position
3 C; 3 25.24 cM
AA seq 3160 aa
MASRARRTAKFSSFQPILAQSPRLLLLLLLLSLVSYVSTQAAGPGAALQSLGLSGTSGVP
TEEAIVVANRGLRVPFGREVWLDPLRDLVLQVQPGDRCTVTVLDNDALAQRPGHLSPKRF
ACDYGPGEVRYSHLGARSPSRDRVRLQLRYDAPGGAIVLPLALEVEVVFTQLEIVTRNLP
LVVEELLGTSNALDDRSLEFAYQPETEECRVGILSGLSALPRYGELLHYPQVQGGAGDRG
TSKTLLMDCKAFQELGVRYRHTAPSRSPNRDWLPMVVELHSRGAPEGSPALKREHFQVLV
RIRGGAENTAPKPSFVAMMMMEVDQFVLTALTPDMLAAEDAESDPDLLIFNLTSAFQPGQ
GYLVSTDDRSLPLSSFTQRDLRLLKIAYQPPSEDSDQERLFELELEIVDPEGAASDPFAF
MVVVKPMNTLAPVVTRNTGLILYEGQYRPLTGPIGSGPQNLVISDEDDLEAVRLEVVAGL
RHGHLVILGSPSSDSAPKTFTVAELAAGQVVYQHDDKDGSLSDNLVLRMSDGGGRHQVQF
LFPITLVPVDDQPPVLNANTGLTVAEGETVPIPPLTLSATDIDSDDSQLVFVLLPPFSSL
GHLLLRQRHVPQEEQGLWQKQGSFYERTVTEWRQQDITEGKLFYRHSGPHSPGPVMDQFM
FRVQDNHDPPNQSGIQRFVIRIHPVDRLPPELGSGCPLRMVVQESQLTPLRKRWLHYTDL
DTDDRELQYTVTQPPTDTDENHSPAPLGTLVFTDNPSVVVSHFTQAQVNHHKIAYRPPGQ
ELGVAARVAQFQFQVEDRAGNVAPGTFTLYLQPVDNQPPEIVNTGFTVEEKGHHILRETE
LHVSDVDTDVTHISFTLTQAPKHGHMQISGRPLHVGGQFHLEDIKHGRISYWNSGDESLT
DSCSLEVSDRHHVVPITLRVNVRPGDREGPMSVLPAGTLESYLDVLENGATEVTANIIKG
AYQGTDDLMLTFLLEGPPSYGEILVNGAPAEQFTQRDILEGSVVYAHTSGEIGLLPKADS
FNLSLSAMSQEWRIGSSIVQGVTVWVTILPVDSQAPEISLGEQFVVLEGDKSVISLTHLS
AEDMDSLKDDLLCTIVIQPTSGYVENISPAPGSEKSRAGVAISAFTLKDLRQGHINYVQS
VHRGVEPVEDRFIFRCSDGINFSERQIFPIVIIPTNDEQPEMFMREFMVMEGMSLVVNRL
ILNAADADIPRDDLTFTITRFPTHGHVMNQLINGTVLVESFTLDQIIESSSIIYEHDDSE
TQEDSFVIKLTDGKHSVEKMVLIVVIPVDDETPRMTINNGLEIEIGETKVINNKVLMATD
LDSDDKSLVYIIRYGPGHGLLQRQKPLGAFENITLGMNFTQDEVDRNLIQYVHFGQEGIR
DLIKFDVTDGTNALIDRYFYVTIGSVDIVFPDVVSKGVSLKEGGKVTLTTDLLSTSDLNS
PDENLVFTITRAPMRGHLECTDRRGLSITSFTQLQLAGNKIYYIHTAEDEVKMDSFEFQV
TDGRNPVFRTFRISISDVDNKKPVVTIHNLVVSESESKLITPFELTVEDRDTPDRLLKFI
VTQVPVHGHLLFNNTRSVMVFTKQDLNENLISYKHDGTESTEDSFSFTVTDGTHSDFYVF
PDTVFETRRPQVMKIQVLPVDNSVPQIVVNKGASTLRTLATGHLGFMITSKILKVEDRDS
LHFSLRFIVTEAPQHGYLLNLGQGNHSVTQFTQADIDDMKICYVLRERANATSDMFHFIV
EDDGGNRLTNQHFRLNWAWISFEKEYYLINEDSKFLDIVLTRRGYLGETSFISIGTRDGT
AEKDRDFKGKAQKQVQFNPGQTRASWRVRILSDGEHEHSETFQVVLSEPVLAILEFPTVT
TVEIIDPGDESTVFIPQSEYSVEEDVGELFIPIRRSGDISRELMVICYTQQGTATSTVRT
SVLSYSDYISRPEDHSSVIRFDKDEREKMCRILVIDDSLYEEEETFQVLLSMPMGGRIGD
KFPGANVTILTDRDDEPAFYFGDTQYSVDESAGYVELQVWRTGTDLSKPSSVTVRSRKTE
SLSADAGTDYVGISRNLDFAPGVNMQTVRVVILDDLGRPILEGIEKFELVLRMPMNAALG
EPSKATVSINDSASDLPKMQFKERVYTCNENDGRVVAMIYRSGDIQHRSSVRCYTRQGSA
QVMMDFEERPNTDVSTVTFLPGEMEKPCVLELMDDAVYEDVEELRLVLGTPQGSSAFGAA
VGEQNETLIKIQDEADKAVIKFGETKFSVTEPSRPGESVVVKIPVIRQGDTSKVSIVRVH
TKDGSATSGEDYHPVSEEIEFKEGETQHTVEIEVIFDGVREMREAFTVHLKPDENMVAET
QATKAIVYIEEIHSMADVTFPSVPHIVSLLIYDDPSKGREDTGPVSGYPVVCITACNPKY
PDYEKTGSICASENINDTLTRYRWLISAPAGPDGVTSPMREVDFDTFFTSSKMITLDSIY
FQPGSRVQCAARAVNTNGNEGLELMSPIVTIGREEGLCQPRVPGVVGAEPFSAKLRYTGP
EDPDFANLIKLTVTMPHIDGMLPAISTRELSNFELTLSPDGTRVGNHKCSNLLDYNEVKT
HHGFLTNATKNPEVIGETYPYQYSVPVRGSSTLRFYRNLNLEACLWEFVSYYDMTELLAD
CGGTIGTDGQVLNLVQSYVTLRVPLYVSYVFHSPVGVGGWQHFDLKSELRLTFVYDTAIL
WNHGIGSPPEAELQGSLYPTSMRIGEEGRLAVNFKTEAQFHGLFVLSHPASFTSSLIVSA
DHPGLTFSLRLIRSEPTYNQPVQQWSFVSDFAVRDYSGTYTVKLVPCTTPSNQEYRLPVT
CNPREPVTFDLDIRFQQVSDPVATEFSLNTHMYLLSKKNLWLSDGSMGFGQESDVAFAEG
DVIYGRVMVDPVQNLGDSFYCSIEKVFLCTGDDGYVPKYSPANAEYGCLADSPSLLHRFK
IVDKAQPETQATSFGDVLFNAKLAVDDPEAVLLVNQPGSDGFKVDSTPLFQVALGREWYI
HTIYTVKSKDNTHRGIGKRSLEYQYHSVVHPGPPQATTKSWKKRAVRSTPSLAGEIGAEN
NRGTNIQHISLNRRGKRQVPHGRIPPDGILPWELNSPSSEVSLVTVLGGLTVGLLTVCLA
VAAAVMCRNRSTKGKDTPKGSGSTEPMMSPQSHYNDSSEV
NT seq 9483 nt   +upstreamnt  +downstreamnt
atggccagccgtgcgcgcaggacagccaagttctccagcttccagccgatactcgcacag
tcgcctaggctgctgctgctgctgctgctcctgtcactggtaagctacgtctccacacag
gctgctggccccggtgcagcacttcagtccctgggtctctccgggacttcgggagtccct
acagaggaagctatagtggtggcaaaccgcgggctccgtgtgcccttcggtcgcgaagtc
tggctggatccgttgcgtgacttggtgctgcaggtgcagccaggagaccgctgcacagtg
accgtgttagacaacgacgcgctggcccagcggccgggccacttgagtcccaagcgtttt
gcgtgcgactatggcccgggtgaggtgcgctactcgcacctgggtgctcgcagcccttcc
cgcgaccgcgtccgcctgcagctgcgctacgatgctccaggaggggcgatagtcctgcca
ctggcactagaggtggaagtggtcttcacccagctggagattgtgactcggaatttacct
ctggtcgtggaagaactgctagggaccagtaatgccttggacgatcggagcttagagttc
gcctaccagcctgagaccgaggagtgccgcgtgggcatcttgtcaggtctgagcgctttg
cctcgttacggagaactccttcactacccacaggtccagggaggggccggagatagaggg
acctctaagacccttttgatggactgcaaagcattccaggagctgggagtccgctaccgc
cacacagcccccagccgctcgcctaacagggactggctgcctatggtggtcgagctgcat
tcgcgaggggctccagagggcagcccggctctaaaacgcgaacacttccaggtgcttgtg
aggattcgaggaggagcggagaacactgcacccaagcccagtttcgtggccatgatgatg
atggaggtggaccagtttgtactgactgctctcactccagacatgctagcagccgaggat
gctgaatccgacccagaccttttgattttcaacctcacctctgccttccagcctgggcag
ggctacctggtgagcacggatgacagaagcctgcctctctcctcctttacacagcgggat
ttgcgcctgctgaagattgcctaccagcctccctctgaagactcggatcaggagcgtctg
tttgaactagagctggagatagtggaccctgaaggagcagcctcagaccctttcgccttc
atggtggtggtgaaacccatgaacacactggctcccgtggtcacacgaaacactggcctt
attctctatgagggtcaatatcggccgctcacgggtcccataggcagtggaccccagaac
ttggtcatcagtgatgaagatgacctagaagctgtgaggctggaggtggtggctgggctc
cggcatggccaccttgttattctgggttctcccagtagcgactctgctcccaagaccttc
acagtggcggagctggcggctggccaggttgtgtatcagcatgatgacaaagacggttca
ctgagtgacaacttggtgctgcgcatgtccgatggaggaggcaggcaccaggtccagttc
ctgttccctatcactttagtgcctgtggatgaccagccgccggtcctgaacgccaacact
gggctgacagtggctgagggggaaactgtgcctatcccacccttgactctcagtgcaacc
gatatagattcagatgactctcagctggtttttgtcctgttgccacccttctcaagcttg
gggcacctgcttctccgccaaaggcatgtcccccaggaagagcagggtctgtggcagaag
caagggtcattttacgagcgaacggtgacagagtggcggcaacaggatataacagagggg
aagctcttctataggcactcggggccccacagccctgggccggtgatggaccagttcatg
tttagagtccaagacaatcatgatccccctaaccagtctgggatccagaggtttgtaata
cgcattcatcccgtggaccgtctccctccagaactgggcagtggctgtccccttcggatg
gtggtacaggaatcccagctcacaccactgaggaaaaggtggctgcactacactgacctg
gacacagatgaccgagagttacagtacacagtgacccagcctcccacggacacagatgag
aaccactcgccggctccactgggcacgttggtcttcactgataatccctcagtggtggtg
agccattttacccaagcccaggtcaatcatcataaaattgcttacaggcccccagggcag
gagctaggagtcgcagcccgagtggctcagttccagttccaagtagaggatcgagctggg
aatgtggctcctggcaccttcaccctttacctgcagcctgtggataaccagccccccgag
attgtcaacactggcttcaccgttgaggagaagggccaccacatcctgcgtgagaccgag
ctgcatgtgagtgatgttgacacggatgtgacccacatctcgttcactctcacacaggcc
cccaaacacggccacatgcaaatatctggacggccactgcatgtaggcggacaattccac
ttggaggacataaagcatggcagaatttcctactggaatagcggggatgagtctttgact
gacagctgctccctggaggtcagcgacagacaccatgtggtgccaatcactctcagagtg
aacgttcggccaggggaccgtgaaggtcctatgtcagtccttcctgctggtactctggag
tcctatctagacgtcttagagaatggggctactgaagtcactgccaatatcattaagggg
gcctatcagggtaccgatgatttgatgctgaccttcctgttagaaggcccaccctcctat
ggggaaatcttagtcaacggagctccagctgagcagttcacccagagggacatcctggag
ggctctgttgtctacgctcacaccagtggtgagattggcctgttgcccaaagctgactct
tttaacctgagtctatcagctatgtctcaagaatggagaatcggtagcagcatcgttcaa
ggcgtcactgtgtgggtgaccatcctccccgtggacagccaagcccctgagatttctctt
ggtgaacagtttgtagtgctggaaggtgacaagagtgtgataagcctgacccacctaagt
gctgaggacatggactccctgaaggatgacctcttgtgcacaatagtcattcagccaacc
tcaggctatgtagagaacatttctccagcaccaggctcagagaaatcaagagccggggtt
gccataagtgccttcacgctgaaggatctcaggcaaggacacattaactatgtccagagt
gtccacagaggagtggagcctgtcgaagaccgctttatattccgttgttctgacggtatt
aacttctctgagagacagatattccccattgtcatcattcctaccaatgacgagcagcca
gaaatgttcatgagggaattcatggtgatggaaggcatgagtctggtggtcaacagactc
atcctcaacgctgctgatgccgacattcccagggatgatctaacgtttactattacccgg
tttccaactcacggtcatgtcatgaaccagttaatcaatggtacagtgttggttgaaagc
ttcaccctggatcagattatagagagttccagcattatttatgagcacgatgactctgag
acacaagaggacagttttgtgattaaactgacagatggcaagcactccgtggagaagatg
gtcctcattgtggtcatccctgttgatgacgagacacccagaatgaccatcaataatggg
ctagaaatagaaattggggaaaccaaagttatcaacaacaaagtcctaatggcaaccgat
ctagactctgatgacaaatcactggtttatattatccgttatggaccagggcatggcttg
ttacagagacaaaaacctctaggtgcctttgaaaatatcactctaggcatgaattttacc
caggacgaagtggacaggaacttgattcaatatgtccactttgggcaagaaggtattcga
gacctgattaaattcgatgtgacagatggaacaaatgctcttatagatcgctacttttac
gtgactattggaagtgttgacattgtcttccctgatgtggtaagtaagggcgtgtccttg
aaagaaggtggcaaagtcactctgacaacggatctgctgagcacaagtgacttgaacagc
cctgatgagaacttagttttcaccattaccagggctcctatgagaggtcacttggagtgc
acggatcgaaggggactgtccatcacttctttcactcagctccagctggctggtaacaaa
atctactacatacacacggctgaggatgaggtcaaaatggacagcttcgagtttcaagtc
accgatgggcggaaccctgtcttccgaactttccggatctcaatcagtgacgtagacaac
aaaaagccagtggtcaccatccacaacctggtggtcagtgaaagtgaaagtaagctgatc
accccctttgaactcactgtggaggacagagatacccctgacaggctcctaaaattcatt
gtcacccaggtccctgttcacggtcacctcctcttcaacaataccagatctgtcatggtt
ttcaccaagcaagacttgaatgaaaacttaatcagctacaaacacgatggcacagaatcc
acggaagacagcttctccttcaccgtgactgacggcacccactcggacttctatgttttt
cctgatacagtgtttgaaaccaggagacctcaagtgatgaaaatccaggtgttacctgtt
gacaacagtgtcccccaaattgtggtgaacaaaggagcttctacccttcgtaccctggcc
actggccatttagggttcatgatcacaagcaaaatactcaaagtggaggacagagacagc
ctgcatttttctctcaggttcattgtgacagaagccccccaacatggctaccttctcaac
ctgggccaaggaaaccacagtgtcacacagttcacccaagctgacattgatgacatgaaa
atatgctatgtcttgagagagagagcaaatgccacaagtgatatgttccatttcatagtg
gaagatgacggtggaaacaggttaaccaaccagcattttcgactgaattgggcgtggatc
tcctttgaaaaagagtattacttgatcaacgaagactccaaatttctagatattgttctt
acacgcagaggatacttgggagaaacttcatttataagtatcggcaccagggatgggact
gcggaaaaagacagagacttcaagggtaaagctcagaaacaggtacagttcaaccccggc
cagaccagggcctcgtggagagtgcgcatcctgagcgacggggaacacgagcactcggag
accttccaagtggttctctcggagcctgtgctggcaatcctggagttccccacagtgact
acagtggagatcatcgacccaggagacgaatcaaccgtgttcattccccagtctgagtac
tctgttgaagaagatgtgggtgagctgttcattcccatcaggagaagtggagacatcagc
cgggagctgatggtgatctgctacacacagcaagggacagccaccagcactgtgcggacg
tccgtgctctcttactctgactacatctccaggcccgaggaccacagcagcgtgatccgc
tttgacaaagacgaacgagagaaaatgtgtcgtattttggtaattgatgactctttgtac
gaagaggaggagactttccaggtccttttgagcatgcccatgggcgggaggatcggtgac
aagtttccaggagccaatgtgaccatcctcacagacagggatgatgagcctgccttctac
tttggggacacccagtactccgtggatgagagtgccggctacgtggagctgcaggtgtgg
aggacggggaccgacctctctaagccttccagtgtcacagtgaggtcccggaaaacagaa
tccctctctgcagatgctggaacagactatgtgggaatcagtcgcaatttagattttgcg
cctggcgtcaacatgcagactgttcgagtggtcattctggatgaccttggacgaccaata
ctggagggaattgagaagtttgaactggtacttcgaatgcctatgaacgctgcccttggg
gagcccagcaaggccaccgtgtccataaatgactctgcctcagacttgcctaaaatgcaa
ttcaaagagagagtgtacacttgcaacgagaatgacgggcgtgtagtggccatgatctac
aggagcggtgacatccagcacaggtcttctgtgagatgttacacgaggcaggggtctgcg
caggtgatgatggacttcgaggaacgcccaaataccgatgtttccactgtcacattcctc
cctggtgagatggagaagccgtgtgtcctcgagctgatggatgatgctgtctatgaggat
gtagaggagctgcgcctggtacttggcacgcctcagggcagctctgcctttggagctgca
gtgggcgagcagaacgaaaccctgataaagatccaggatgaggctgacaaagctgttatc
aaatttggagaaaccaaatttagtgtcactgagcccagcagaccaggagagtcggtggtt
gtcaaaatcccggtcatccgtcaaggagacacttcaaaggtctccatcgtgagagtccac
accaaggatggctcggctacctccggagaggattatcaccctgtgtcagaagaaatcgag
tttaaggagggagaaacccaacacactgttgaaattgaagtaatcttcgacggggtgaga
gagatgagggaggccttcactgttcacctaaaaccagatgaaaatatggtggcagagaca
caggcaaccaaggccattgtatatatagaagaaatccacagcatggcagatgtcaccttt
ccttctgtccctcacattgtgtccttgctgatatacgatgatccctccaaaggcagagag
gacactggacctgtgtctggctacccggttgtctgcattacggcctgcaaccccaaatat
ccagactatgagaaaacaggctctatttgtgccagtgagaacatcaacgacactttgacc
cgatacagatggctgatcagcgctcccgctggccctgacggtgtgaccagccccatgaga
gaggtcgacttcgacaccttcttcacatcatccaaaatgattacattagactccatatac
tttcagcctggctcccgggtccaatgtgcggcccgagcagtgaacaccaatgggaatgaa
ggcctggaactaatgagccccatcgttaccatcggcagagaggaaggtctctgtcagccc
cgtgtgcctggggtagtgggggcagagccattctccgctaagttgcgctacactggccca
gaggacccagactttgccaacctcatcaaactcactgtcactatgccgcacatagacggc
atgctccctgccatctccacaagagagctgtccaactttgagctgaccctcagccctgac
ggcacgagagttgggaatcacaaatgctccaacctgctggactacaatgaagtaaagacc
caccatggcttcctgaccaacgccacaaagaacccagaggtcattggagagacctatcct
taccagtacagtgtgccggtcaggggttccagcaccttacgcttctaccgaaacctgaac
ctggaagcatgtctgtgggagtttgtcagctactatgacatgacggagctcctggctgac
tgtggaggaaccatcgggaccgatggccaggtcctcaacctcgtgcagtcctacgtgacc
cttcgagttcctctgtacgtttcctacgtgttccactcccccgtgggcgtgggcggctgg
cagcatttcgacttgaagtcagagctccgactcacattcgtgtacgacactgccatcttg
tggaaccatgggatcggcagccccccggaagctgagctgcaaggctctctttacccaacc
agcatgcgcattggtgaggagggacgcctggctgtgaacttcaaaacagaggctcagttc
catggcttgtttgtgctgtcccatcctgcttcctttaccagctcactgatcgtgtcagct
gaccatccgggcctcacattttccctccgccttatacggagtgaaccaacctacaatcag
ccagtccagcagtggagtttcgtgtcagactttgcggtccgtgactactcgggcacctac
acagtaaagttggtaccctgcaccactccatccaaccaggagtaccgtctgccagtcacc
tgcaaccccagagagcctgtcacctttgaccttgacattcgattccaacaggtcagcgat
cccgtggcgactgagttcagcctgaacacccacatgtatctgctgtctaagaagaatctc
tggttgtctgatgggtccatgggatttgggcaggaaagcgacgtggcttttgcagaaggg
gatgtgatttatggccgtgtcatggtcgatcctgtccagaacctcggtgactccttttac
tgcagcattgagaaggtgttcttatgcacgggggatgacggctacgtgcccaagtacagc
ccagcgaatgcggaatatggctgcctggctgattctccttcactcttacatagattcaaa
atcgtggataaggctcagccagagacacaagccaccagctttggagatgtcctgtttaac
gccaaactggcagtggatgaccctgaagctgttctcttagtgaatcagcctggatccgat
ggttttaaagtagactcaacaccactctttcaggttgccttgggccgagagtggtacata
cacacaatctatacggtaaagtctaaggacaacacccatcgaggcattggcaagaggagc
ctggagtaccagtatcactcagtggtgcatcccggaccaccgcaggcaaccaccaagagc
tggaagaagagagcagtcaggagcacgccctccctcgcaggggagatcggtgctgagaac
aaccggggaacaaacatccaacatatctccctgaaccgccgtggcaagaggcaggtcccc
cacggaagaattcctcctgacggcatcctgccctgggagctcaatagtcccagctctgaa
gtgagccttgtcactgtcctgggaggcctcacggtgggcttgctcacagtctgcctggct
gtggctgcggccgtcatgtgcaggaacaggagcactaagggcaaggatactccaaagggc
tctggaagcactgagcccatgatgtccccgcagagccactacaacgacagctcggaggtg
tga

KEGG   Mus musculus (mouse): 329872
Entry
329872            CDS       T01002                                 

Gene name
Frem1, BC037594, D430009N09, D630008K06, QBRI, crf1, crf11, eye<m02Jus, eye<m02Jus>, eyes, eyes2, heb, qbrick
Definition
(RefSeq) Fras1 related extracellular matrix protein 1
  KO
K23380  FRAS1-related extracelluar matrix protein 1/2
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04512  ECM-receptor interaction
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    329872 (Frem1)
SSDB
Motif
Pfam: Cadherin_3 Cadherin_4 Lectin_C Big_9 Calx-beta
Other DBs
NCBI-GeneID: 329872
NCBI-ProteinID: NP_808531
MGI: 2670972
Ensembl: ENSMUSG00000059049
Vega: OTTMUSG00000000404
UniProt: Q684R7
Position
4; 4 C3
AA seq 2191 aa
MHSPGCTGPKAQWFLLLQLLLLHLDRVSATFISINRGLRVMKGSSAFLSGDHLRVAVPKE
KDACRLEVVMNEPVTQRVGKLSPQVFDCHFLPNEVKYVHNGCPILDEDSVKLRLYRFTET
DTFMETFLLRVYLVEPDCNIIRMSSNVLEVTEFYGLSQAIDKNLLQFDYDRTASLDCTIR
LDPLRTQLPAHGKLVVVNRKSEGPRGDQPHSFFSETELGAGLKCPDGSCALELKQVASLK
VSCEEFLLTGFHYQHMQPPSPNIDYIPIQLDLTDRRSKTVYKSESAWLPVYIRVGIPNQV
PRAAFMAMFVLEVDQFILTPLTTSVLDCEEDETPKPLLVFNITKAPLQGYVTHLLDHTRP
ISSFTWKDLSDMQVAYQPPNSSHPERRHYTMELEVYDFFFERSAPITVHISIRTADTNAP
RVSWNTGLNLLEGQSRAITWEQFQIVDNDDIGAVQLVTIGGLQHGRLTVREGKGFLFTVT
DLQAGVVRYHHDDSDTTKDFVAFRIFDGHHSSHHKFPINILPKDDSPPFLITNVVIELEE
GKTILIQGSMLRASDMDSSDDYIFFNITKFPQAGEIMKKPGPRLIGYPVPGFLQRDLFSG
IIYYRHFGGEIFEDSFEFVLWDSHEPPNLSVPQVVTIHITPVDDQLPKEAPGISRHLVVK
ETEVAYITKKHLHFLDMESRDGELIYTVTRPPCFSFSHRHLDAGKLFMVDSIPKLTKNPT
APGLSSFTQGLILISANQHTCSSQFASQHAVNHMKVAYMPPMQDIGPSPRHVQFTVSVSN
QHGGALHGICFNITVLPVDNQVPEVFTNTLRVVEGGQCTISTEHILVSDVDTPLDSISLS
LKERPLHGGVELDGFPLNPRGTFSWRDLNTLKVWYQHDGSEVLQDEIFLEVTDGTNSAAF
VLHIEVFPVNDEPPILKADLIPMMHCSEGGEVTITPEYISATDADSDDLELLFLIAREPQ
HGVVRKAGLHVDRFSQGDVISGAVTYKHTGGEIGLEPCSDTVVLVVSDGEADPLMNGCCY
DGPDSSVPLHKSFPTYQLNITVHPVDNQPPSIIIGRMLTVDEGFSAALTTHHLTVVDWDT
APDDLKFMLASQPQFGYLENALPSAGFEKSNIGIRIASFQWTDMKASHINYVQSRHLRVE
PTADQFTVYATDGKHRSLETTFHVIINPTNDEAPDLAVQNITVYEGHMVELDSSIISATD
RDIPKDPLLFSIALKPQHGLLVDAAISKDSHQIKQLQHEIHSFSVDLLKNGMKLVYAHDD
SESSADNFVIQLSDGKHKILKTISVNITPVNDETPTLSKKAEISMAVGDTRVLSSAVLSA
TDKDSPREKIHYVFERLPQNGQLQLKIGRDWVPLSTGMQCTQEDVDLNLLRYTHAGKTDS
QDGDSFTFYLWDEDNRSPAFDCHIIIEDMGKGDIVIHAKPLVVVKGDRGLLTTATLLAVD
GADKPEELLYLITSPPRHGQVEYVHSPGVPIASFSQMDIAGQTVCYIHKSRTAVPTDSFR
FTISNGLQTQRGVFEITLQTVDSALPVLTKNKRLRLAEGAMGLLSADHLQLTDPDTPPEN
LTFFLAQLPRHGYLFLRGKALQHNFTQRDVDSGGVAYQHSGGGAREDYFTFLATDRKNQG
FVVDGKVQKEPVRFTIQVDQLDKAAPRITHLHSPTQVGLLKNGCYGIYITSRVLKASDPD
TEDDQIIFKILRGPLYGRLENTTTGEFIHERFSQKDLSHKTILYIINPSLQVTSDILEFQ
AMDPTGNTATPQSLDLRWSYIEWAQTAYEVCENVGLLPLEVTRRGYPMDSAFVGVEVNQV
SATVGKDFTVTPSKLLQFDPGMSTKMWNIAITYDGLEEDDEVFEVILNSPVNAVLGTQTK
AAVKILDSKGGRCHPSNSFNQSKHSTWGKGPWHPLPSGSSSLTTSGSPLLERPPPSFTSG
DALQGFGLTDLTQRKTMTQGNGKSVLPSSVCRNGTDTIYNYHGIVSLKLEGDRFSAHKRK
AKISIVSQPQRTIKVAELPLADKVESTTDLHFLRQGLRPLFPKNCSVDLKGLFHFEESTH
RLYQCDGISWKAWSPQTKGLEDRSCPGGWLLHSGYCHILVTRQKGTWTTATRACREQHQG
DLVTVLSRRHMQWLWAMSGRKPFWIGLKNQPRTGHWEWIGGEPVAFTNWRRGAPLHPKPG
KNCALVQKRGQWQTKNCSKGKAHNFVCSRKL
NT seq 6576 nt   +upstreamnt  +downstreamnt
atgcactctccaggctgcactgggcccaaggctcagtggttcttgctgctccagctgctt
ctgctgcacctggaccgggtcagtgccaccttcatcagcatcaaccggggcctgagggtg
atgaagggtagttctgccttcctgtctggagatcacctgagggttgcagtccctaaagaa
aaggacgcctgcagactggaggtggtgatgaacgagcccgtaacccagagggttgggaaa
ctctctccacaggtctttgattgccattttcttcccaacgaagtgaagtatgttcacaat
ggatgcccaattctggatgaagactctgtgaagcttagactttacaggtttactgaaaca
gacaccttcatggaaacctttctcttgcgggtttatcttgtggaaccagactgtaacatc
atccgtatgagcagtaatgtgttggaagtgactgaattctatggcttatcgcaagccatt
gataagaacctgctccagtttgattatgataggactgccagcctggattgcaccatcaga
ctagacccactgaggactcagctgccagctcacggcaagctggtcgtggtgaatcgtaag
tcagaggggcctcgtggagatcagccacacagcttcttctctgagacagagctaggggct
ggactgaagtgtccagatggaagctgtgccctggaattgaagcaagtggcaagtctgaaa
gtgagctgtgaggagtttctgctgacggggtttcactaccaacacatgcagcccccttca
cccaacattgattacatccccattcagttggatctcaccgacagaaggagcaaaaccgta
tacaagtcagagagtgcgtggttgcctgtctatatcagagttggcattcctaaccaggtc
ccaagggctgcatttatggccatgtttgttctggaggtggaccagttcatactgacccct
ctgacaacctccgttctggactgtgaggaggatgagactccgaaacccttgttggtgttc
aacatcactaaagccccactccagggctatgtgacccacctgctggatcataccagaccc
atctcttcattcacctggaaggatctcagtgacatgcaagttgcctaccagccaccaaac
agcagccaccctgagaggagacattacacgatggagctggaggtgtacgacttcttcttt
gagaggagtgcccccatcactgtccacatctccatcagaacagcagacacgaatgcacca
cgggtgtcttggaatacaggtttgaatctcctagaggggcagtctcgggccatcacttgg
gaacaatttcagatcgttgacaatgatgacattggtgctgtgcagttggtcaccattggt
ggcctgcagcatggacggcttacagtacgagaggggaaaggatttctcttcaccgtgact
gaccttcaagctggagttgtccgctatcatcacgatgacagtgataccaccaaagacttt
gtggctttcaggatattcgatggccaccacagcagccaccacaagtttcctatcaacatc
ttgcctaaagatgacagccccccattcctcatcaccaatgtcgtgattgaactagaagag
gggaagaccatcttgatccaagggtctatgttgagagcttcagatatggactccagtgat
gactacatcttctttaatatcacaaagtttccacaggctggggagatcatgaagaagcca
gggccaagactgatagggtatcctgtccctggcttcctgcagagagacctgttcagtgga
atcatttactatcgtcactttggtggagaaatctttgaagattcctttgaattcgtactg
tgggacagccatgagcctccaaatctctcagtgccacaggtggtgacaattcatatcact
ccagtagatgaccagcttcctaaagaagctcctggcatttcccggcatttggttgtcaag
gaaacagaggtggcctacatcactaaaaagcacctacatttcctagacatggaatcccgt
gatggggaactcatctacacagtaacacgccctccatgtttctccttcagccacagacac
ttggatgctgggaagctattcatggtggacagcataccaaagctaaccaaaaatccgaca
gccccagggctaagttcatttactcagggcttgattctgatctctgcaaatcagcacacg
tgttcatctcaatttgcttcacagcatgccgtgaaccatatgaaagtggcctacatgcca
cccatgcaagatataggcccctcccctcgacatgtgcagttcacagtgtctgtcagtaac
cagcatggaggtgctttgcatggaatctgcttcaacatcacagttctcccagtggacaac
caggttcccgaggtattcaccaacaccctgagagtggtcgagggcggtcagtgcaccatc
agcacagagcacattttggtttctgatgtggacaccccgctagacagcatcagcctctct
cttaaggagaggcctctgcatggcggggtagagctggacggatttcctctaaacccaaga
ggcacattttcttggcgagacctcaataccttaaaagtttggtatcaacatgatggatct
gaggttcttcaggatgagatatttttggaggtcacagatggcacaaattcagcagcattt
gttctccacattgaggtgttccctgtgaatgatgagccacccattctgaaggctgacctc
atccccatgatgcactgctctgagggtggagaggtgaccatcacccctgaatacatttcc
gctactgatgcagacagcgatgacttagaactgctgtttctgattgcccgagagcctcag
catggagtggtgagaaaggctggacttcacgtggacaggttctctcagggagatgtcatc
tcaggggctgtgacatacaaacatacaggtggcgagattggccttgaaccttgttctgac
actgttgtattggtggtttcggatggtgaagctgaccctttgatgaacggctgttgctac
gatggacctgattcatctgttcctcttcataagtccttccccacataccagctcaacatc
acagtacatccagtcgacaaccagccaccttcaattataataggtaggatgctcacagtg
gatgaaggcttctcagcagcccttactactcatcacttgactgttgttgattgggacact
gccccggatgacttaaaattcatgttggcttctcagccccagtttggctacttagaaaac
gcactgccttctgcaggctttgagaaaagtaacatcggcataaggatagcctcattccag
tggacagacatgaaggcttcacacattaactatgtgcagtccaggcacctgagagtggaa
ccaactgctgaccagttcacagtatatgccacagacgggaagcatcgctccttggagaca
acatttcacgttatcatcaaccccacaaacgatgaagctcctgaccttgcagtacagaac
atcactgtgtatgaggggcacatggtagaactggattcttccatcatcagtgctactgac
agggatattcccaaggaccccttgctcttcagcatcgctctcaagccccagcacggcctg
ctcgtcgatgctgccatcagcaaggactcccatcagatcaagcagctgcaacacgaaatc
cacagcttctccgtggaccttctcaagaatggaatgaagctggtctatgcccacgacgac
tcagagagctctgctgataacttcgtgatccagttgtcagacgggaaacataaaatcctt
aaaaccatctcagtaaacattaccccagtgaatgacgagacaccaacgctaagcaagaag
gctgaaatctcaatggctgtgggcgatactcgcgtcctgtctagtgctgttctttcagcc
acagataaagactcgcccagagagaagattcactatgtatttgaaagacttccccaaaat
ggacaacttcaacttaagatagggagggactgggtccctctctccactggcatgcagtgc
acccaggaggatgtggacctgaacttgctaagatacacgcatgctggtaaaacggactcc
caggatggagacagcttcaccttctacctctgggatgaggacaacaggtcacctgcattt
gactgtcacatcatcattgaagacatgggcaaaggtgatattgtcattcatgcaaaacca
ctcgtggtagtcaaaggtgacagaggtctcttgacgactgccacccttctggctgtggat
ggagcagacaagcctgaggaactgctctacctcatcacctccccaccacggcatggccaa
gtggagtacgtccactctcctggagtccccattgccagcttcagccaaatggacatagca
ggacagacagtgtgctacatacacaagagcaggacagctgtccccactgacagcttcaga
tttaccatcagcaatggactgcagacccagcgtggggtgtttgaaatcacactgcagact
gtggacagcgccttgcctgtgctgaccaagaacaaaaggctgaggctagccgaaggggcc
atgggcctcctgtccgctgatcaccttcagctgactgaccccgacacacctccagagaac
ctgaccttctttctggctcagctcccacgccacgggtacctcttcctgagagggaaagca
ctccaacacaacttcacccagcgagatgtggacagcgggggcgtggcctaccagcactca
ggaggcggcgcccgggaggactattttacttttctagccacagacaggaagaaccaaggc
tttgttgtggatgggaaagttcagaaagagcctgttcgcttcacaatccaggtggatcag
ctggacaaggcagcgccccgtatcacacacttgcactcccctactcaagtggggctcttg
aaaaatggctgctatgggatttacatcacttcccgtgtgctgaaggcatcagaccctgac
acagaggatgaccagatcatctttaagattttacgaggcccattgtacggacgtctggag
aacacaacaacaggtgaattcatccacgagcgatttagccagaaggacttaagccataag
accatcctttacatcataaacccttctttgcaagtgacttccgatatcctggaatttcag
gccatggaccccacagggaacactgccactccccagagcttggacttgagatggtcgtat
attgaatgggcccagactgcatatgaggtttgtgagaatgtgggcttattgcccttggaa
gttaccagaaggggatatcccatggactcagcctttgtgggtgtagaggttaaccaagtg
tcagctacagttggaaaagattttactgtcactccatccaaactgcttcaatttgaccca
ggaatgtcaactaagatgtggaatatagcaattacctatgacggattagaggaagatgat
gaggtctttgaagtaattctgaactcccctgtgaatgcggttcttggcacgcagacaaaa
gcggcggtgaaaattttggactcaaaaggaggacggtgccatccttcaaattccttcaac
caaagcaagcacagcacgtgggggaagggcccttggcatccgctgccctcaggctcatcc
tcgctcaccacttcaggttctcctcttctggaaaggcctcctccatctttcaccagtgga
gatgctcttcagggttttggtctcaccgacctcactcaaaggaagacaatgacccagggg
aatggcaaatcagttctcccatcctctgtttgtagaaatgggacagacaccatctacaat
taccatggtatagtttccttgaaactagagggcgacagattctcagctcacaaacggaag
gccaaaatatccattgttagtcagccacagaggacaatcaaggtggcagagctgcctcta
gctgataaggtggaatccacaactgatttgcactttctcagacagggtctgcggcccttg
tttccaaagaattgttctgtggacttaaagggactctttcattttgaagaaagcacccac
agattgtatcaatgtgatgggatctcctggaaagcctggagcccccaaaccaaggggctg
gaggacagatcctgcccaggtggatggctccttcattctggctactgtcacatcttggtc
acaagacagaaaggcacctggaccacagctacccgagcttgcagagaacagcaccagggc
gaccttgtgaccgtactctccagaaggcatatgcagtggctatgggcgatgagtggaaga
aaacccttctggataggcttgaagaaccaaccgaggactggccactgggagtggatcgga
ggtgaacctgttgcttttaccaactggaggagaggggcccctctgcacccaaaacctgga
aagaactgtgctttggttcagaaaagaggacaatggcagacaaagaactgtagcaaaggc
aaggctcacaattttgtgtgctcaaggaaactctga

DBGET integrated database retrieval system