KEGG   Mus musculus (house mouse): 242050
Entry
242050            CDS       T01002                                 
Symbol
Igsf10, 6530405F15Rik, 9030224D03, Adlican2, CMF608
Name
(RefSeq) immunoglobulin superfamily, member 10
Organism
mmu  Mus musculus (house mouse)
SSDB
Motif
Pfam: I-set Ig_3 ig Ig_2 V-set LRR_8 C2-set_3 C2-set_2 LRR_4 Ig_6 LRRNT LRR_9 eIF-1a
Other DBs
NCBI-GeneID: 242050
NCBI-ProteinID: NP_001156356
MGI: 1923481
Ensembl: ENSMUSG00000036334
UniProt: Q3V1M1
Position
3:complement(59224156..59256836)
AA seq 2594 aa
MQKRGREVSCLLISLTAICLVVTPGSRVCPRRCACYVPTEVHCTFRYLTSIPDGIPANVE
RVNLGYNSLTRLTENDFSGLSRLELLMLHSNGIHRVSDKTFSGLQSLQVLKMSYNKVQII
EKDTLYGLRSLTRLHLDHNNIEFINPEAFYGLTLLRLVHLEGNRLTKLHPDTFVSLSYLQ
IFKTSFIKYLYLSDNFLTSLPKEMVSSMPNLESLYLHGNPWTCDCHLKWLSEWMQGNPDI
IKCKKERIPSSPQQCPLCMNPRISKGRSIAMVPSGSFLCTKPTIDPSLKSKSLGIQEDNG
SASVSPQDFIEPFGSLSLNMTDLSGNKANVICSIQKPSRTLPIAFTEENDYIMLNMSFST
NLVCSVNYNHIQPVWQLLALYSDSPLILERKPQHTETPLLSPKYQQVALRPEDTFTNIEA
DFKADPFWFQQEKISLQLNRTATTLSTLQIQFSTDAQITLPKAEMRPVKRKWTMILMMNN
TRLEHTVLVGGTIALDCPGKGDPSPHLEWVLADGSKVRAPYVSEDGRILIDKKGKLELQM
ADTFDAGLYHCISTNDADADILTYRITVVEPYVENKHENGALHTVIMGEILDLPCLSTGI
PDASISWILPRNTVFSQSSRDMQILNNGTLRILQATPKDQGHYRCVAANPSGADFSSFQV
SVQMKGQRTIEHDRDIDGSGLEEPKPSVLLKQPPSLKLPASSLTGTEAGKQVSGIHKKNK
HRDLTHRRRGDSTLRRFREHRRQLPLSARRIDPQHWAALLEKAKKNSVLRKQENTTVKPT
PLAIPLVELAGEEKDASGLTPPDEEFTVLKTKAFGVPERSPTADSRPVNHGFVTSSASGT
EVSSTVNPQTLLPTHLPDFKLFNVVDSAAVSKSMNRPVTSKIEDTTHQNPIIIFPSVAEI
QDSAQVGRTSSQSAHPATGGAMATYGYTTMLSSFTNKANTVLQSANPTESYGPQIPLTEV
SRVSSNNSLAHTTKDPGFSKRPSDSHTTAPSLFQTPRNNSTGNVGRERTIWSRGRAISPY
RTPVLRRHRHRIVRPALKGPANRNISQVSATEPPGMCRTCSSTERLTMATAALSVTGSSH
TTLPKANNVGIISEESTTVVKKPSLLLKNKQDVDIETITTTINYFRSESTHMTPTEASMI
SAPTSISLGKTPIDTSGHLSMPRTIQAGTDLVVTPPLSSPLSQPSIPTKATSTKLSRRKI
PWHPIFANNHNKEGMLKNLHQFGLQKNTATKPPEKAPLLPTDHGSSSPSTTLLASLTPAQ
SATMAATRRNGTEVQGARSLSAGKEQPFINSFLVLPSTTRKRSSTLSFLSVETPTVTTPP
VIASAIISETQEVRSKKAKDQTKGSLKNRKGPTITPRQISGYSTYSVPTTTDTPLAFSHS
PGKVTGRTVSTAAPHSAASLLGITELPQKCTHTSGNITASETTLLSKSQESTAMKRASAT
PPLLSSGAPRMPTPSPPPFTKVVVTDSEVPAVFKMMSNRMVTIYESSRHDIDLQQPSAEA
SPNPEILTGSTDFPLSSLLTSTPMPAPRVDKPQDSQWKPSPWPENKFQLRSYSETIEKGK
RPEISLSPHLSFPEASTHALHWNAQRHAEKSVFDKKPAQNPTSKHLPYDSLPKTILKKPR
IIGGKAASFTVPTNSDVLLPCEAVGDPKPTIHWTRVSSGREISRGIQKTRFHVLPNGTLS
IQRVSIQDRGQYLCAASNPLGVDHLHVTLSVVSYPARILESHVKEITAHSGSTVKLKCRV
EGMPRPTISWILANQTVVSETPEGSRKVWVTPDGTLIIHNLSLYDRGFYKCVANNPSGQD
SLLVKIQVITAPPVIIEQKRQAIVGVLGESLKLPCTAKGTPQPSVHWVLYDGTELKPLQL
THSRFFLYPNGTLYIRNIVSSVRGTYECIATSSSGSERRVVILRVEEQETVPRIETASQK
WTEVNLGEKLLLNCSATGDPKPTIIWKLPSKVVIDQWHRMGSRIHVYPNGSLVIGSVTEK
DGGDYLCVARNKMGDDLVLMHVRLRLTPAKIEHKQHFKKQVLHGKDFQVDCKASGSPVPE
VSWSLPDGTVVNNVAQADDSGYRTKRYTLFHNGTLYFNKVGMAEEGDYICSAQNTLGKDE
MKVHLTVLTAIPRIRQNYRSNVRIKAGDTAVLDCEVTGEPKPNVFWLLPSNNVISFSNDR
FIFHANGTLSINKVKPLDSGKYVCVAQNPSGDDTKTYKLDIVSRPPLINGLYANKTVIKA
TAIQHSKKHLDCRADGVPPPQITWIMPDNIFLTAPYYGGRITVHQNGTLEIRNIRLSDSA
DFTCVVRSEGGESVLVVQLKVLEMLRRPTFRNPFNEKVVAQVGKPVAMNCSVDGNPTPEI
IWILPDGTQFANGPQNSPYLMASNGSLIVYKATRNKSGKYRCTARNKVGYIEKLILLEIG
QKPVILTYEPGMIKSAGGESLSLHCVSDGIPKPNVKWTTPGGLVIDRPQVGGKYILHENG
TLVIKETTAHDRGNYICKAQNSVGQAVISVPVTIVAYPPRIINYLPRSMLRRTGEAMQLH
CVALGVPKPQITWETPGYSLLSTATERRPHRSEMLPLQGTLVIQNLRASDSGVYKCRAQN
VLGADYATTYIQVL
NT seq 7785 nt   +upstreamnt  +downstreamnt
atgcagaagagaggcagggaagtcagctgcttgctgatctccctcactgccatctgcctg
gtggtcacccctgggagcagggtctgtcctcgccgatgtgcctgctatgtgcccacagag
gtgcactgtacatttcggtacctgacctccatcccagacggcatcccagccaatgtggaa
cgagtcaatttagggtataacagcctcactagattgacagaaaatgacttttctggcctg
agcagactggagttactcatgctgcacagcaatggcattcacagagtcagtgacaagacc
ttctcgggcttgcagtccttgcaggtcttaaaaatgagctataacaaagtccaaataatt
gagaaggatactttgtatggactcaggagcttgacccggttgcacctggatcacaacaac
attgagtttatcaaccccgaggcgttttacggactcaccttgctccgcttggtacatcta
gaaggaaaccggctgacaaagctccatccagacacatttgtctctttgagctatctccag
atatttaaaacctccttcattaagtacctgtacttgtctgataacttcctgacctccctc
ccaaaagaaatggtctcctctatgccaaacctagaaagcctttacttgcatggaaaccca
tggacctgtgactgccatttaaagtggttgtccgagtggatgcagggaaacccagatata
ataaaatgcaagaaggaaagaatcccctccagtcctcagcagtgtcccctttgcatgaac
cccaggatctctaaaggcagatctattgctatggttccatctggctcgttcctgtgtaca
aagccaaccattgatccatcactgaagtcaaaaagcctgggtattcaggaggacaatgga
tctgcctccgtctcacctcaagatttcatagaaccttttggctccttgtctttgaacatg
acagacctgtctggaaataaggccaatgtgatctgtagtatccaaaagccttctaggaca
ttaccaattgcattcactgaagaaaatgactacatcatgctaaatatgtcattttcaaca
aatcttgtgtgcagtgtcaattataatcacatccagccagtgtggcaactcctggctttg
tacagtgactctcctctgatattagaaaggaagccccagcatactgagactccactgctg
tctcccaaatatcaacaggtggctcttaggcctgaagacacttttaccaacatagaggct
gatttcaaagcagatcctttttggttccaacaagaaaaaatttccctgcagctcaacaga
actgctaccacacttagcacattacagatccaattttccacggatgctcaaatcacttta
ccaaaggcagagatgagaccggtgaaacgcaaatggaccatgattctgatgatgaacaat
accagactggaacatactgttttggttggcggcactattgccctggactgtccgggcaaa
ggtgacccttcacctcacttggaatgggttttagctgatgggagtaaagtgagagcccct
tatgttagtgaggatgggcgaatcctaatagacaaaaaggggaagttggaactccagatg
gctgatacctttgatgcaggtctttaccattgcataagcaccaatgatgctgatgcagat
attctcacatacaggataactgtggtagagccctatgtagaaaacaagcatgaaaatgga
gctctgcacacagtaattatgggtgagatactcgatcttccatgcctttccactggtatt
ccagatgcttctattagctggattcttccccggaacactgtgttctctcagtcatcaaga
gacatgcaaattcttaacaatgggaccttaagaatattacaggctacaccaaaagatcaa
ggccattaccgatgtgtagcagccaacccatcaggggctgatttttccagttttcaagtt
tcagtccaaatgaaaggtcaaaggacaattgagcatgacagggacatagatggatctgga
cttgaagaacccaagcccagtgttctccttaagcagccaccatctttgaaactccctgca
tcatctttgacagggacagaggctggaaaacaagtctctgggatacataagaaaaacaaa
catagagacttaacacatcgacggcgtggggattccactctccggagattcagggaacac
aggaggcagctccctctctctgctcggagaattgacccccaacactgggcagcactttta
gaaaaagcaaagaagaattctgttctaaggaagcaagaaaataccacagtaaagccaacg
ccactggctattccacttgtggaactcgctggggaggaaaaagacgcctccggcctgact
cctccagatgaagaattcacggttctgaaaactaaggcttttggtgtcccagaaaggtca
ccaactgctgactctagaccagtaaatcatggctttgtgacaagttcagcttctggcaca
gaagtctcctccaccgtgaatccgcaaacactactacccacgcaccttcctgatttcaaa
ttatttaatgttgtggacagtgcagctgtgtcaaagagtatgaaccgacctgtaacaagc
aagatagaagatacaacacatcaaaacccaatcattatctttccatcagtagctgaaatt
caagattctgctcaggtggggagaacgtcttcccaaagtgcacaccccgcaacaggggga
gccatggctacctatggctataccaccatgcttagtagcttcaccaacaaagccaataca
gtcctgcagtcagcaaatccaacagaaagttatggacctcagatacctttaacagaagta
agtagagttagcagtaataactccttggctcacactactaaagatccaggcttctccaag
cgcccttcagattcccacaccactgccccttctttatttcaaactcctagaaacaacagt
acaggtaacgtgggaagagagaggacaatttggagcagagggcgagctataagtccatat
agaactccagttctccgtcggcatagacacaggattgtgaggccagcactcaagggacct
gctaacagaaatataagtcaagtttcagccacggagccccctgggatgtgccgaacctgt
tcttccacagaaaggctcaccatggctacggcagcactgtcagttacaggctcatcccac
actaccctccccaaagctaacaatgttgggattatttcagaagagtctaccactgtggtc
aagaagccatctttactattgaagaacaaacaagatgtagatatagagacaataacaacc
actataaactatttcagaagtgaaagtacccacatgactcccactgaagcaagcatgatt
tctgctccaacatccatatccctgggaaaaactcctatagacactagtggtcacctgagc
atgcctaggaccatccaagctggaacagatttagtggtgacaccaccactttccagtcca
cttagccaaccctcaataccaacaaaagcaacaagcacaaaactctcaagaagaaaaatt
ccctggcacccaatctttgcaaataaccataacaaagaggggatgctaaagaatctgcat
cagtttggtttacaaaagaacacagccactaagcctcctgaaaaagctcctcttttaccc
acagatcatggttcctcctcaccttctacaacactcttggcaagtctgacgccagctcag
tctgcaacaatggctgccactcggcgcaatggcactgaagtgcaaggtgccagaagtctc
tctgcagggaaagagcagcccttcatcaactccttcctagtgcttcctagcaccacaaga
aagagatctagtacattaagcttcctgtcagtggaaacccccacagtgacaactcctcct
gttattgcatctgccattatctctgaaacccaagaagtacgatccaaaaaagcaaaagac
caaacaaaggggtctctgaagaacaggaaaggcccaaccatcacccccaggcagatttct
ggctatagcacatactcagttccaacaacaactgatactcccttggctttcagtcattcc
ccgggaaaagtcactggtaggactgtaagtacagctgctcctcactcagcagcttctctc
ctgggcataactgaactgccccagaaatgcactcatacttcgggaaatataacagcttcg
gaaacaactctgttgagcaaatcacaggagagcaccgcaatgaaaagagcctccgccaca
ccaccactcctcagcagtggggcaccccgaatgcctactccttcccctcctcccttcact
aaggttgtggttacagacagtgaggtcccagcagttttcaagatgatgtcaaataggatg
gtcaccatatatgaatcttcaaggcacgatatagatctgcagcaaccctcagcagaggct
agccccaatcctgagatcttaactggatccactgactttcccctctctagtctgttgacc
tccactcctatgccagcaccaagagtggataaaccacaggattctcaatggaagccttct
ccctggccagaaaacaaatttcagctcaggtcatactcagaaaccattgaaaagggcaaa
aggccagaaataagcctgtcaccccacctcagctttccagaggccagcactcatgccttg
cattggaatgcacagaggcatgcagaaaagagtgtctttgataagaaacctgctcaaaac
ccaacttccaaacacctgccctatgactctctgcctaagactatattgaagaaaccaaga
ataattggaggaaaggctgcaagctttactgttccaactaattcagatgtccttcttcct
tgcgaggctgttggagacccaaagcccaccatccactggaccagagtctcatcaggacgt
gaaatatcccgagggatacagaaaacccggtttcatgtgcttcccaatggcaccttgtcc
atccagagggtcagcattcaggaccgtggacagtacctgtgcgctgcctctaatccacta
ggtgtagaccaccttcatgtcactctgtctgtggtctcctaccctgctaggattctggag
agtcatgtcaaggagatcacagctcattccggaagtactgtgaaacttaagtgtagagta
gaaggtatgccaagacctacaatttcctggatactcgcaaaccaaacagtggtctcggaa
acacccgagggaagccggaaggtctgggtgacacccgatggaacgttgatcatccataat
ttgagtctttatgaccgtggtttttacaagtgtgtagccaacaacccatctggccaggat
tcactgttggttaagatacaagtcatcacagctccccctgttattatagagcaaaagaga
caagccatcgttggcgttttaggtgaaagtttgaaactgccctgcactgcaaagggaact
ccccagcccagtgttcattgggtcctctatgatgggactgaactaaaaccactgcagttg
actcattccaggtttttcttgtatccaaatgggaccctgtatataagaaacatcgtttct
tcagtcaggggcacttatgaatgcattgctaccagctcctcgggctcagagagaagggta
gtgattctaagagtagaagagcaagagacagttcccaggatagaaactgcctcgcagaaa
tggacagaggtgaatttgggtgagaaattactactgaactgctcagctactggggatccg
aaacctacaataatctggaagttaccatccaaggttgtcattgaccagtggcacagaatg
ggcagccggatccatgtctacccaaatggctccttggttattggatcggtgacagaaaag
gatggtggtgactacttatgtgtggcaagaaacaaaatgggagatgacctggtcctgatg
catgtccgcctaagactgacacctgccaaaattgaacacaagcagcattttaagaagcaa
gtactccatgggaaagatttccaagttgactgcaaggcttctggctcccctgtgcctgag
gtatcctggagtttgcctgatggaacagtggtgaacaatgtagcacaagctgatgacagt
ggctacaggaccaagaggtacaccctcttccacaacggaaccttgtatttcaacaaagtt
gggatggcagaggaaggagattatatttgctctgctcagaacaccttagggaaagatgaa
atgaaagttcacctaacagttctaacagccatcccacggataaggcaaaactacaggagc
aatgtaaggatcaaggctggagacacagctgtcctggactgtgaggtcactggggaaccc
aagccaaatgtattttggttgctgccttccaacaatgtcatttcattctccaatgacagg
ttcatatttcatgccaatggaactttgtccatcaataaagtgaaaccgcttgactctggg
aagtatgtgtgtgtagctcaaaatcctagtggggatgacactaagacatacaaactggat
attgtctctaggcctccattaatcaatggtttgtatgcaaacaaaactgttattaaagcc
acagccattcagcactccaaaaaacacttggactgcagagcagatggggtcccaccaccc
cagatcacatggattatgccagacaatattttcctcacggctccatactacggaggcaga
atcaccgtgcatcaaaatggaaccttggaaattcggaacataaggctttctgattctgcg
gatttcacctgtgtggttcggagcgaaggaggagagagtgtgttggtggtgcagttaaaa
gtactggaaatgctgagaagaccaacattcagaaacccattcaatgaaaaagtagttgcc
caggttggcaagcctgtagcaatgaactgctctgtggatgggaacccaacacctgaaatt
atctggatcttacctgatggcacacaatttgctaatgggccacaaaattccccatatctg
atggcaagcaatggttctctcattgtttacaaagcaactcggaacaagtcaggaaagtat
cgctgtacagcaagaaataaggttggctacatcgagaaactcatcctgttagaaattgga
cagaagccagtcattctgacatacgaaccggggatgataaagagcgccggtggggaatcg
ctatccctgcattgtgtgtctgatggaatccctaagccaaatgtcaaatggactacgcca
ggtggccttgtaatcgacagacctcaagtcggtggaaaatacatattgcatgaaaatggc
acgttggtcatcaaagaaacaacagctcatgacagaggaaattatatctgtaaggctcaa
aacagcgttggccaggcagttattagtgttcccgtgacgattgtggcctaccctccccga
attataaactaccttcccaggagcatgctcaggaggacaggagaggcaatgcagctccac
tgtgtggccttgggagtccccaagccacaaatcacctgggagacgccgggatactccctg
ctctcaacggcgacagaaagaaggccccacagaagtgagatgcttcccctacaaggtacg
ctggtcattcagaatctacgagcctcagattctggcgtctataaatgcagagcacagaac
gtgcttggtgccgattatgcaacaacttacatccaggtcctctga

DBGET integrated database retrieval system