KEGG   Mus musculus (house mouse): 242109
Entry
242109            CDS       T01002                                 
Symbol
Zfp697, 9430053K19, AI467503, Znf697
Name
(RefSeq) zinc finger protein 697
Organism
mmu  Mus musculus (house mouse)
SSDB
Motif
Pfam: zf-C2H2 zf-H2C2_2 zf-C2H2_4 Zn-ribbon_8 zf_UBZ DZR DUF3268 Yippee-Mis18 zinc_ribbon_15 XPA_N HVO_2753_ZBP DUF2039 zf-C2H2_6 C1_4
Other DBs
NCBI-GeneID: 242109
NCBI-ProteinID: NP_766451
MGI: 2139736
Ensembl: ENSMUSG00000050064
UniProt: Q569E7 G5E8C0
Position
3:98289278..98508893
AA seq 569 aa
MEQEDNQGVCEYQTSEDRGMDSDLENSEDREGDPEERGMGSNPWDTEDRGHLEQEVDSNP
QDDDLRGDSRERDIASTVCSEGRLSEEERAILREEEDDQPGVADMALFPGLSESDSISRS
PRGEEDEEEEDEEEESAGENRLIEEEDPLPTPVLPWRRHLSLGGRHRGDKPAHRRFHRLH
HPMAMDLGELDSLMASIMDAPTICPDCGESFSPGAAFLQHQRIHRLAEAAAVASLEPFGL
AGECGGVVGMMGMGMGVGMGVAGGFGAGPTLARPPREKPFRCGECGKGFSRNTYLTNHLR
LHTGERPNLCADCGKSFSWRADLLKHRRLHTGEKPYPCPECGEAFSLSSHLLSHRRAHAA
AGGGAGSAGSAAALRPFACGECGKGFVRRSHLANHQRIHTGEKPHGCGECGKRFSWRSDL
VKHQRVHTGEKPYMCSECGETFSVSSHLFTHKRTHSGERPYVCRECGKGFGRNSHLVNHL
RVHTGEKPFGCGQCEKRFSDFSTLTQHQRTHTGEKPYTCLECGKSFIQSSHLIRHRRIHT
GNKPHKCAGCGKGFRYKTHLAQHQKLHLC
NT seq 1710 nt   +upstreamnt  +downstreamnt
atggaacaggaagataatcagggtgtgtgtgaataccagacttctgaagacagaggcatg
gattctgacttggagaactctgaggaccgagaaggggacccagaagaaagaggaatgggc
tctaatccatgggacacagaagatagaggccacctggagcaggaagtggactccaaccca
caggatgatgatctaagaggggactcacgagagagggacatagcgtccactgtctgttca
gaggggcggctgagtgaggaagaaagggctatcctccgtgaggaagaggacgaccagcct
ggtgtggctgacatggctctgttcccaggactgtcagaatctgacagcatatcccggagt
ccgcggggagaggaagatgaagaggaggaagacgaagaagaggaaagcgctggggagaac
cgcttgatagaggaggaagatccattgcctactcccgtgcttccttggaggcgtcacctc
tccctgggcggtcgacaccggggtgacaagcctgctcaccgccgcttccaccggctccat
caccccatggccatggacctcggggaactagacagcctgatggccagtatcatggacgcg
cccaccatctgcccagactgcggggagagctttagcccgggcgccgcattcctgcagcac
cagcgcatccaccgcctggcagaggccgccgccgtggccagcttggagcccttcggtttg
gccggcgagtgcggaggagtggtggggatgatgggcatgggtatgggcgtgggcatgggc
gtggccggcggcttcggggcggggcccacgctggcccggccccctcgcgaaaagcccttc
cgctgcggggagtgcggcaaaggcttcagccgcaacacctacctgaccaaccacctgcgg
ctgcacacgggcgagcggcccaacctgtgcgccgactgcggcaagagcttcagctggcgc
gccgacctgctcaagcaccggcgcctgcacacgggcgagaagccctacccgtgcccggag
tgcggcgaagccttcagcctcagctcgcacttgctcagccaccggcgcgcgcacgcggcg
gcgggcggcggcgcgggctcggcgggctcggcggcggcgctgcggcccttcgcatgcggg
gagtgcggcaaggggttcgtgcgccgctcgcatctggccaatcaccagcgcatccacacc
ggcgagaagccgcacggctgcggcgagtgcggcaagcgcttcagctggcgctcggacctg
gtgaagcaccagcgcgtgcacacgggcgagaagccctacatgtgctccgagtgcggcgag
accttcagcgtgagctcgcacctcttcacgcacaagcgcacgcactcgggcgagcggccc
tacgtgtgccgggagtgtggcaagggcttcggccgcaactcgcacctcgtcaaccacctg
cgcgtgcacaccggcgagaagcccttcggctgcggccagtgcgagaagcgcttcagcgac
ttctccacgctcacgcagcaccagcgcacgcacaccggcgagaagccctacacatgtctc
gagtgcggcaagagcttcatccagagctcccacctcatccgccaccggcgcatccacacc
ggcaacaagcctcacaaatgcgcgggctgtggcaagggcttccgctacaagacgcacctt
gcacagcaccagaagttgcacttgtgttag

DBGET integrated database retrieval system