KEGG   Mus musculus (house mouse): 242151
Entry
242151            CDS       T01002                                 
Symbol
Kcna10, Gm1962, Kcna8, Kv1.8
Name
(RefSeq) potassium voltage-gated channel, shaker-related subfamily, member 10
  KO
K04881  potassium voltage-gated channel Shaker-related subfamily A member 10
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:mmu04040]
    242151 (Kcna10)
Ion channels [BR:mmu04040]
 Voltage-gated cation channels
  Potassium channel, voltage-gated (Kv)
   242151 (Kcna10)
SSDB
Motif
Pfam: Ion_trans BTB_2 Ion_trans_2 PKD_channel
Other DBs
NCBI-GeneID: 242151
NCBI-ProteinID: NP_001074609
MGI: 3037820
Ensembl: ENSMUSG00000042861
UniProt: B2RQA1
Position
3:107090459..107103037
AA seq 511 aa
MDVCSWKEMEVALVNFDNSDEIHEEPGYATDFDPTSSKGRPGSSPFSNWRVLISDNTNHE
TAFSKIPGEYVDPPGPEPVVLNEGNQRVIINIAGLRFETQLRTLNQFPETLLGDREKRMQ
FFDSMRNEYFFDRNRPSFDGILYYYQSGGKIRRPANVPIDVFADEISFYELGSEAMDQFR
EDEGFIKDPETLLPTNDFHRQFWLLFEYPESSSAARGVAVVSVLVVVISITIFCLETLPE
FREDRELKVVRDPSINTNKTGLSQTMFTDPFFMVESTCIVWFTFELVLRFVVCPSKTDFF
KNIMNIIDIISIIPYFATLITELVQETEPSAQQNMSLAILRIIRLVRVFRIFKLSRHSKG
LQILGQTLKASMRELGLLIFFLFIGVILFSSAVYFAEVDEPESHFSSIPDGFWWAVVTMT
TVGYGDMCPTTPGGKIVGTLCAIAGVLTIALPVPVIVSNFNYFYHRETENEEKPNIPGEL
DKILNSMGSRMGSTESLNKTNGSCSAEKSRK
NT seq 1536 nt   +upstreamnt  +downstreamnt
atggatgtgtgtagctggaaagaaatggaggttgctctggtcaattttgataactcggat
gaaatccatgaagagccaggctatgccacagactttgacccaaccagctcaaaaggccgc
cctggtagcagtcccttttccaattggagagtccttatcagtgacaacaccaaccatgaa
actgccttctccaagatcccaggagagtatgtggatcccccgggacctgagccagtggtc
ttgaatgagggaaaccaaagggtgatcatcaacattgctggtctgagattcgagactcag
ctcagaacacttaatcaattcccagagacactcctgggagaccgggagaaaaggatgcaa
ttttttgactccatgagaaatgagtatttctttgatagaaacagacctagttttgatgga
atcttatattattaccagtctggtgggaaaatacggcggccagccaacgtgcctatcgat
gttttcgctgatgagatctccttctatgaactgggtagcgaggccatggaccagttccgg
gaggatgaaggcttcattaaggaccctgagacactgctgcccaccaatgactttcaccgg
caattctggcttctctttgagtaccccgagagctccagtgcagctcgaggagtggctgtg
gtctcggttttggttgtagtcatctccatcaccatcttctgcctggagacactcccagag
ttccgagaggacagggagctgaaggtggtcagagaccccagcatcaatacaaacaaaaca
ggcctctcccagaccatgttcactgatcctttcttcatggtggagtccacctgcatcgtg
tggttcacctttgagctggtgctccggtttgtggtctgccccagcaagactgacttcttc
aagaacatcatgaatattattgacatcatctccatcatcccctactttgcaaccctcata
acagagctagtacaggagaccgagccaagtgcccagcagaacatgtccctggccatcctg
aggatcattcgtctggtgagggtcttccgcatcttcaagctttctcgacactctaaaggg
ctgcagatcctggggcagacgctgaaggcttccatgcgggagctggggctgctcatcttc
ttcctcttcattggggtcatccttttctccagtgcagtctactttgctgaggtggatgag
ccagagtcccatttctctagcattcctgatggcttctggtgggctgtggtcaccatgaca
actgtaggctacggtgacatgtgcccaaccaccccaggaggaaagattgtgggtactctg
tgcgccattgctggtgtcctcaccatcgccctccctgtgcctgtcattgtctccaatttc
aactacttctaccaccgtgagactgagaacgaggagaagccaaacatcccaggagaactt
gacaaaatcctcaacagcatgggctccagaatggggagtactgagtctctcaacaagacc
aatggcagctgctctgcagagaagtccaggaagtga

DBGET integrated database retrieval system