KEGG   Mus musculus (mouse): 242248
Entry
242248            CDS       T01002                                 

Symbol
Bank1, A530094C12Rik, AI451642, AVIEF, BANK
Name
(RefSeq) B cell scaffold protein with ankyrin repeats 1
Organism
mmu  Mus musculus (mouse)
SSDB
Motif
Pfam: TIR_3 DBB Ank_2
Other DBs
NCBI-GeneID: 242248
NCBI-ProteinID: NP_001028522
MGI: 2442120
Ensembl: ENSMUSG00000037922
Vega: OTTMUSG00000052558
UniProt: Q80VH0
Position
3 G3; 3 63.04 cM
AA seq 783 aa
MLPVASGTRGSTQDLFQVGLAPPGNAKDILLLYEEDAEEWALYLREIFMRVVEREAILLY
PLHSFSSSHLEMLNFYAYKCKLLIISNSLLKDLTPKKCQFLEKILHSTGNVVTLLCGMES
SDPFYQLLSIPRKRWEISTEQDPDGYISVIRQILDQGPEDYLEVSIPTDSRAKYPEDTSG
QKGTDVLASLRPSVPRVLVLPGEIPCEKPGEIFILLKDELIGEILEVEFISTNKRLRARP
ARWNKSVWHMKAADFPAGSVTVNIHCDGIIKATTEIKYCSAAKATESPFRVSDPGKSLCQ
KSIEELDNVLASIFKREIPYYEFKHLQAETYPQKERTHTTELPTLLHCAAKFGLKNLALH
LLQCSGATRAARMKATDGSDLLHIAERHGHEELKEVFEDFLSQNTGRNSKQENDYEEDVI
SFSTYSPSMPSPASLHELRKTHRRNTDRSEEPERSVEMKEEEAGAEARRSLSEGERESSE
NQYDDLYVFIPGFDTEGNSEEPLPHCRPPLLPPRPGTAASQLERPHFTSQGKVLEDQMER
SQNWNDLNARPETREESSREEKKEEAQEEEEEEENPYAFAETEDNEYDLILASKSVKKRT
GNRSFIINRPPAPTPRPTHIPPKEETTPYIAQVFQQKAARRQSDGDKFYSLPKKPDKTRM
EGPTFPSTRDYLTTGQEELILLQERVKNGKMSVDEALEKFKHWQMGKSGLEMIQQEKLRQ
LRDNIIGKRPEDENAYDKLTIVHHPSGNTAHNENMLYNSPFNSKFPARIQVEKEFGFCCK
KDH
NT seq 2352 nt   +upstreamnt  +downstreamnt
atgcttcctgtggcttctggcactaggggtagcacccaggatctgttccaggttggccta
gcacctccaggaaatgcaaaagatatcctgttgctatatgaagaagatgctgaggaatgg
gctctatacttgagagaaatatttatgcgtgttgtagaaagagaagcaatcctgttatat
cccttgcacagtttttcttcttcacatttggaaatgctaaacttctatgcttacaaatgt
aaacttctgataatatccaatagtctacttaaagacctgacgccaaagaagtgtcagttt
ctggagaagatacttcactcaacaggaaatgtagtgactttgctttgtgggatggagagc
tcagatcctttctatcagttattaagtatccccagaaagagatgggagatctcaacagag
caggatccggatggttacatctctgtcatcagacagatcttagaccaaggtcctgaagac
taccttgaggtcagcattccaacagactcaagagccaagtatcctgaggacacaagtgga
cagaagggaactgacgtcctagcatctctgagaccatctgtgcctcgggtactagtgctt
cctggggaaattccatgtgagaaacctggtgagatattcattctgttgaaagatgaacta
attggcgaaattctagaggttgaatttatatcaaccaacaagcgcctcagagcacggcca
gcacgttggaataagagtgtctggcatatgaaagctgcagattttccagctggctcggtc
actgtcaatatccactgtgatggaatcatcaaggccacaacagagattaaatactgttca
gcagcaaaagcaacagaaagtccatttagagtgtcagacccgggcaagagtttgtgccag
aaaagcatcgaagaacttgataatgttcttgcatctatattcaagcgtgagataccatat
tatgaattcaaacatctccaagctgaaacttaccctcaaaaagaacgtactcacaccaca
gagctcccaacacttcttcactgtgcagcaaaatttggcttaaagaatctggctcttcat
ctgctgcagtgttcaggagcaaccagggcagctagaatgaaggcgacagatggttcagac
ctgctgcatattgctgaaaggcatggtcatgaagaactcaaggaagtctttgaagacttt
ctcagccaaaacactggcagaaatagcaagcaagaaaatgactatgaagaagatgtaatc
tcattttccacatattcaccctccatgccgtctccggcatcccttcatgaactcaggaag
acacacaggcggaacacagacagatctgaggagcctgaaaggtctgtggagatgaaggag
gaagaagcaggtgctgaggcaagacgcagcctgtcagagggtgaaagggaaagctccgag
aaccagtatgacgatctgtatgttttcatccctgggtttgacaccgaaggcaactctgaa
gagcctctcccacactgcaggccacctctgctgccaccacgaccaggcactgctgcctcc
cagctagaaagacctcactttacctcacaaggaaaagtactggaagaccaaatggaaaga
agtcaaaactggaatgatctcaatgcaagaccagagacaagagaggaatccagcagagaa
gaaaagaaagaagaagcccaggaggaggaggaagaagaagaaaacccatatgcatttgca
gagactgaagacaatgagtatgacctgatactggccagtaagagtgtcaagaaaagaact
ggaaatcggtctttcattataaacagaccaccggctcccacaccccggcccacgcacatc
cctcccaaagaagaaacaacaccttacatagctcaagtgttccaacaaaaggcagcccga
agacaatctgatggtgataagttctacagtctacctaagaaacccgacaaaactcggatg
gagggcccaaccttccctagtacaagggattatctgactactgggcaggaagaactgatc
ctcctgcaggagagagtcaagaatgggaaaatgtctgtggatgaagctctggagaaattt
aaacattggcagatgggaaagagtggtctggaaatgattcagcaggaaaagctacggcaa
ctacgagacaacattattgggaaaaggccagaagatgaaaatgcctatgataaactgacc
attgtgcaccatccaagtggtaatactgcccacaatgaaaatatgttgtacaacagtcca
ttcaacagtaagtttcctgctcgaatccaagttgaaaaggagtttggtttctgctgcaaa
aaagatcattaa

DBGET integrated database retrieval system