KEGG   Mus musculus (mouse): 242409Help
Entry
242409            CDS       T01002                                 

Gene name
Tmem8b, 4930500O05Rik
Definition
(RefSeq) transmembrane protein 8B
Organism
mmu  Mus musculus (mouse)
SSDB OrthologParalogGFIT
Motif
Pfam: DUF3522
Motif
Other DBs
NCBI-GeneID: 242409
NCBI-ProteinID: NP_001078977
MGI: 2441680
Ensembl: ENSMUSG00000078716
Vega: OTTMUSG00000007050
UniProt: B1AWJ5
Position
4; 4 A5-B1
AA seq 472 aa AA seqDB search
MNMPQSLGTQPLPPEPPSLGTPIEGSGAIAPTEHCWPVRPTLRNELDTFSVHFYIFFGPS
VALPPERPAVFALRLLPVLDSGGVLSLELQLNASSLRQENVTVFGCLTHEVPLSLGDAAV
TCSKESLAGFLLSVSATSRVARLRIPFPQTGTWFLTLRSLCGVGPRFVRCRNATAEVRLR
TFLSPCVDDCGPYGQCKLLRTHNYLYAACECKAGWRGWGCTDSADALTYGFQLLSTLLLC
LSNLMFLPPVVLAIRSRYVLEAAVYTFTMFFSTFYHACDQPGIVVFCIMDYDVLQFCDFL
GSLMSVWVTVIAMARLQPVIKQVLYLLGAMLLSMALQLDRHGLWNLLGPSLFALGILATA
WTVRSVRRRHCYPPTWRRWLFYLCPGSLIAGSAVLLYAFVETRDNYFYIHSIWHMLIAGS
VGFLLPPRAKTDRRVPSGARARGCGYQLCINEQEELGLVGPGGTTVSSICVS
NT seq 1419 nt NT seq  +upstreamnt  +downstreamnt
atgaacatgccccagtcactaggcacccagccactgcctccggagccaccatccctgggg
actcctatagaagggtctggagccatagcacccactgagcactgctggccagtgcgtccg
actctgcgcaatgagctggataccttctctgtccacttctacatcttttttggtcccagc
gtggcccttccacctgagcgcccagctgtatttgccctgaggctgttgccggtgctggac
agcgggggcgtccttagcctggagctccagctcaatgcgagctctctgcgccaggaaaat
gtaacagtattcggatgcctgactcatgaggtgcccttgagcctgggggatgctgctgtg
acctgttccaaagagtccctggcaggcttccttctctcggtcagtgccacctccagagtg
gccaggcttcgaatcccattcccacagacggggacctggttcctgaccctccgttctctg
tgcggggtgggacctcggtttgtgcggtgccgcaatgcaacggcagaagtgcggctgcgt
accttcttgtccccatgtgtggatgactgtgggccctatggccagtgcaaactgctgcgc
acccacaactacctgtacgcggcctgcgagtgcaaggctgggtggcggggctggggttgc
acagacagtgccgacgcgctcacctatggattccagctgctgtccacactcctcctctgc
ctgagcaacctcatgtttttgccacctgtggtcctggccattcggagccgatacgtgctg
gaagctgccgtctacaccttcaccatgttcttctccacgttctatcatgcctgtgaccag
ccaggcattgtggttttctgtatcatggactatgatgtacttcagttctgtgatttcctg
ggctccttaatgtccgtgtgggtcaccgtcatagccatggctcgtctgcagcctgtgatc
aagcaggtgctgtatctgctcggggctatgctgctgtctatggctctgcagcttgaccgg
catggactctggaatctgctgggacccagtctctttgccctcgggatcttggccacagct
tggacagttcgcagcgtccggcgccggcactgttacccaccgacatggcgccgctggctt
ttctacctgtgtcccggcagcctgattgctggcagtgccgttctactgtatgctttcgtg
gagactcgggacaactacttctacattcacagcatttggcacatgctcattgctggcagt
gtgggcttcctgctgcctccccgtgccaagactgaccgccgggtcccttctggagcccgg
gccaggggctgcggttaccagctgtgcatcaatgaacaggaggagctgggacttgtgggc
ccaggagggaccactgtcagcagcatctgtgtcagctga

DBGET integrated database retrieval system