KEGG   Mus musculus (mouse): 242557
Entry
242557            CDS       T01002                                 

Gene name
Atg4c, Apg, Apg4, Apg4-C, Apg4c, Atg4cl, Aut, Autl1
Definition
(RefSeq) autophagy related 4C, cysteine peptidase
  KO
K08342  cysteine protease ATG4 [EC:3.4.22.-]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04136  Autophagy - other
mmu04140  Autophagy - animal
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    242557 (Atg4c)
   04136 Autophagy - other
    242557 (Atg4c)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mmu01002]
    242557 (Atg4c)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    242557 (Atg4c)
   03029 Mitochondrial biogenesis [BR:mmu03029]
    242557 (Atg4c)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.-  
     242557 (Atg4c)
Peptidases and inhibitors [BR:mmu01002]
 Cysteine peptidases
  Family C54: Aut2 peptidase family
   242557 (Atg4c)
Membrane trafficking [BR:mmu04131]
 Autophagy
  Autophagosome formation proteins
   Atg8 conjugation proteins
    242557 (Atg4c)
Mitochondrial biogenesis [BR:mmu03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Autophagy-related proteins
    242557 (Atg4c)
SSDB
Motif
Pfam: Peptidase_C54
Other DBs
NCBI-GeneID: 242557
NCBI-ProteinID: NP_001139439
MGI: 2651854
Ensembl: ENSMUSG00000028550
Vega: OTTMUSG00000007980
UniProt: Q811C2 Q3UYA5
Position
4; 4 C6
AA seq 458 aa
MEASGTDEVDKLKTKFISAWNNMKYSWVLKTKTYFSRNSPVLLLGKCYHFKYEDESKMLP
ARSGCAIEDHVIAGNVEEFRKDFISRIWLTYREEFPQIEASALTTDCGWGCTLRTGQMLL
AQGLILHFLGRAWTWPDALHIENADSDSWTSNTVKKFTASFEASLSGDRELRTPAVSLKE
TSGKCPDDHAVRNEAYHRKIISWFGDSPVAVFGLHRLIEFGKKSGKKAGDWYGPAVVAHI
LRKAVEEARHPDLQGLTIYVAQDCTVYNSDVIDKQTDSVTAGDARDKAVIILVPVRLGGE
RTNTDYLEFVKGVLSLEYCVGIIGGKPKQSYYFAGFQDDSLIYMDPHYCQSFVDVSIKDF
PLETFHCPSPKKMSFRKMDPSCTIGFYCRNVQDFERASEEITKMLKISSKEKYPLFTFVN
GHSKDFDFTSTAASEEDLFSEDERKNFKRFSTEEFVLL
NT seq 1377 nt   +upstreamnt  +downstreamnt
atggaggcttcaggaacagatgaagttgacaagctaaaaactaaatttatatctgcttgg
aacaatatgaaatatagttgggtgttgaaaacaaagacatattttagtagaaattcacct
gttttattgcttggaaaatgttatcattttaaatatgaagatgaaagcaagatgttgcct
gcaagatcaggatgtgccattgaagatcatgtaattgcagggaatgtggaagagttccgt
aaggatttcatttctagaatatggctgacctacagggaagaatttcctcaaatcgaagct
tcagccttgacgacagactgtggctggggctgcacgctgcggaccggccagatgctgctg
gctcagggactcatactccattttctcggtagagcttggacctggcctgatgcgctgcac
attgagaacgcagactctgactcatggacttccaacactgtcaaaaagtttactgcatcg
tttgaagcttcactttcgggggacagagaactcagaactccagcagtttctctgaaggaa
acatctgggaagtgtcccgatgaccacgcagtgcggaatgaggcttatcacaggaagatc
atctcttggtttggagattcccccgtggccgtctttggcttacatcgtctgatagagttt
gggaagaagtctgggaaaaaagctggcgattggtatggaccagcggtggttgctcacatt
ttaagaaaagcagttgaagaagcaaggcatccggatttgcaagggctaactatttatgtt
gcccaggactgtacagtttacaattctgacgtgattgataagcagactgactccgtgaca
gctggagatgcacgtgacaaggctgtcattattttagttcctgttagactcggtggagaa
aggaccaataccgactatctggagtttgtgaagggtgttttaagccttgaatactgtgta
ggtatcattggcggcaaacctaaacagtcatattactttgctggatttcaagatgacagt
ttgatttacatggatcctcattactgccagtcttttgtagatgtcagcataaaggatttc
cctctcgagacattccactgtccatctcctaaaaagatgtcatttcgaaaaatggatcct
agttgtacgataggattttactgtcgaaatgtccaggactttgaacgagcgtctgaagaa
atcactaagatgttgaaaatttcctctaaggagaaatatccactatttacttttgtaaat
ggccattccaaagactttgattttacatctaccgcagccagtgaagaagaccttttctca
gaagatgaaaggaagaatttcaaaagatttagcacagaagagtttgtcctcctttaa

DBGET integrated database retrieval system