KEGG   Mus musculus (house mouse): 242584
Entry
242584            CDS       T01002                                 
Symbol
Dnai4, BC028975, Wdr78
Name
(RefSeq) dynein axonemal intermediate chain 4
  KO
K24723  dynein axonemal intermediate chain 4
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   03037 Cilium and associated proteins [BR:mmu03037]
    242584 (Dnai4)
   04812 Cytoskeleton proteins [BR:mmu04812]
    242584 (Dnai4)
Cilium and associated proteins [BR:mmu03037]
 Motile cilia and associated proteins
  Dynein arm
   242584 (Dnai4)
Cytoskeleton proteins [BR:mmu04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Dyneins
     242584 (Dnai4)
SSDB
Motif
Pfam: WD40 ANAPC4_WD40
Other DBs
NCBI-GeneID: 242584
NCBI-ProteinID: NP_666366
MGI: 2385328
Ensembl: ENSMUSG00000035126
UniProt: E9PYY5
Position
4:complement(102895262..102971521)
AA seq 807 aa
MHSSPTSTRKQASFAASASAQPRKSISFINPSKSSAGKGYAASNPNKLAVSRTMGFLTDM
KPAEKLNVPSAKTVQVLDSKGVDVTPRPLYHPDPHAASAKPNKLLTSQEGSLGSDYISSY
SLYQNTLNPSMLGQYTRSVLGSSSVSKSSISTTESMSEDLEDSSYKRDRLASFTDVRVLR
STAEAAISKEELEKTIEIILTETETLRFFDLPTVMFSTESEEAEKIIEKNKKYETLCRNR
LGNDLYVERMMQTFNGAPKNKEVQCEKIILEEKGVVATTWDLYDSYNIPETLLAAKRSGY
SSKGSLPAKDRDPKIQDSESSSLMDIENVILAKVQEDEEDNSEAILKSDKLHQDLFYMER
VLMENVFQPKLAAYRQLPVYKEHEPEEPEETLQVENLKVAEDEPKKEDEEEVEMELELEI
ATEQSTIPANLERLWSFSCDLTKGLNVSSLSWNKANPDLLAVGYGNFGFREQKKGMACCW
SIKNPMWPERIYQSSYGVTSVDFSNSSPNLLAVGYHNGTVAIYNVQSSHNIPVLDSSESP
QKHLGPVWQVQWIEQDRGTTGDDKREILVSISADGRISKWIIRKGLDCHDLMRLKRTTAT
GGKKGGEKEKKGEALISRQAPGMCFAFHPKDTNIYLAGTEEGLIHKCSCSYNEQYLETYR
GHKGPVYKVTWNPFCPDVFLSCSADWGVMIWHQDTVKPFLSFYPTTYVVYDVSWSPKSAY
IFAAANENRVEIWDLQISTLDPLIVNVANPGIKFTTVLFAKETDCLLVGDSDGQVAVYEL
RNMPTASDTSRGDVINILLGPKTNHTG
NT seq 2424 nt   +upstreamnt  +downstreamnt
atgcatagctctccgacgagcacccgcaagcaggccagcttcgccgcgagtgccagtgca
caaccaaggaagtccatcagctttattaacccatcaaaatcaagtgcagggaaaggatat
gctgcctcaaacccaaacaaattggccgtatcaagaactatgggttttttaactgacatg
aagccggcagaaaaactaaacgttcctagcgctaaaacagtacaggtgcttgattcaaaa
ggagttgatgtcacaccccgacctctctaccatccagatccacatgctgcgtcagcaaag
ccaaacaaactcttgacatcacaagaaggatcgcttggatcagattatatttcttcctat
agcctctatcagaatacactaaaccctagcatgttagggcagtacacaaggtcagtcctg
gggagcagttcagtgtcgaagtcaagcatctcaacaactgagtcgatgtcagaggacctt
gaagattcctcttacaagagggatagattggccagttttacagatgtacgagttctgagg
tccacagctgaggcagccatatcaaaggaagagctggagaagactatagaaatcatcctc
actgagacggaaacactgagattctttgacctgccaacagtcatgttctcaacagagtct
gaagaagctgagaaaataatagagaaaaataagaagtatgaaaccctttgtagaaataga
ttaggcaatgacttatacgtagaaagaatgatgcagacatttaatggagcaccaaagaat
aaagaggttcagtgtgaaaaaatcatactggaagaaaaaggtgtagtggccactacctgg
gatttgtatgattcttacaacattccagaaactttgctagctgcaaaacgatctggatat
tcaagtaaaggaagtttgcctgctaaagaccgggacccaaaaatacaagacagtgaaagt
agttctctaatggacatagaaaatgtaattctggctaaagttcaagaggatgaagaagac
aactcagaggcaatattaaagtctgataagcttcatcaagacttattttacatggaaagg
gttttaatggaaaatgtgtttcagccgaagcttgcagcctaccgtcaactccctgtttat
aaagaacacgaacctgaagagcctgaagaaactttgcaagtggaaaatcttaaggtagca
gaggacgagccgaagaaggaagatgaagaagaagtggaaatggaactagagctagagata
gctacggaacagtcaacaataccggctaatttggaacggctctggtctttctcctgtgac
ttaacgaaaggcctcaacgtgagcagcctttcctggaataaagcaaacccagaccttttg
gctgttggctatggaaactttggatttagagaacaaaaaaaaggaatggcctgctgctgg
tcaataaagaaccccatgtggccagagcgtatttatcagagttcatatggagttacttct
gtggacttttcaaacagctcacctaatctgctagcagttggctaccacaatggcaccgtt
gcgatttacaatgtgcagagcagccacaacattccagttctggacagtagtgaatcacct
caaaaacatttgggacctgtttggcaagtgcagtggatagagcaagacagaggaactact
ggggatgacaagagagaaatcttggtgtccatatcagccgatggaaggatctccaagtgg
atcatccgcaaaggactggattgtcatgatttgatgcgactgaagcgaaccactgcgaca
ggcggcaagaagggaggggaaaaggagaagaagggcgaggccttgatatcccgacaggct
ccggggatgtgctttgcttttcaccccaaggacacgaacatctatctggctggtacagaa
gaaggccttattcacaagtgttcttgttcatacaatgagcaatacctagagacctataga
ggacataagggtccagtgtataaagtcacatggaacccattctgtcccgatgtcttcttg
agctgttctgcagattggggtgttatgatctggcaccaggataccgtcaagccttttttg
agtttttacccaacaacttacgttgtttatgatgtttcctggtcccccaaatccgcatat
atttttgccgctgcaaatgagaatagagtagagatttgggaccttcagatcagcactttg
gaccctctgatcgtgaatgttgctaaccctggaatcaagtttacaaccgttctgtttgcc
aaagagacagattgccttctagtgggagacagtgatggccaggttgcagtctacgagctg
agaaatatgcctactgcttctgacactagccggggagacgtaatcaacattctgcttggg
cccaagacaaaccacacaggatga

DBGET integrated database retrieval system