KEGG   Mus musculus (house mouse): 242653
Entry
242653            CDS       T01002                                 
Symbol
Cldn19
Name
(RefSeq) claudin 19
  KO
K06087  claudin
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04514  Cell adhesion molecules
mmu04530  Tight junction
mmu04670  Leukocyte transendothelial migration
mmu05160  Hepatitis C
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    242653 (Cldn19)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    242653 (Cldn19)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    242653 (Cldn19)
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    242653 (Cldn19)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   03037 Cilium and associated proteins [BR:mmu03037]
    242653 (Cldn19)
   04147 Exosome [BR:mmu04147]
    242653 (Cldn19)
Cilium and associated proteins [BR:mmu03037]
 Other cilia and associated proteins
  Stereociliary proteins
   242653 (Cldn19)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of ovarian cancer cells
   242653 (Cldn19)
  Exosomal proteins of colorectal cancer cells
   242653 (Cldn19)
SSDB
Motif
Pfam: PMP22_Claudin Claudin_2 Amastin Mntp SUR7 Prominin
Other DBs
NCBI-GeneID: 242653
NCBI-ProteinID: NP_001033679
MGI: 3033992
Ensembl: ENSMUSG00000066058
UniProt: Q9ET38
Structure
Position
4:119112638..119119635
AA seq 224 aa
MANSGLQLLGYFLALGGWVGIIASTALPQWKQSSYAGDAIITAVGLYEGLWMSCASQSTG
QVQCKLYDSLLALDGHIQSARALMVVAVLLGFVAMVLSVVGMKCTRVGDSNPTAKSRVAI
SGGALFLLAGLCTLTAVSWYATLVTQEFFNPSTPVNARYEFGPALFVGWASAGLAMLGGS
FLCCTCPEPERANSIPQPYRSGPSTAAREPVVKLPASVKGPLGV
NT seq 675 nt   +upstreamnt  +downstreamnt
atggccaactcgggcctccagctcctgggctacttcctagccttgggcggctgggtgggc
atcatcgccagcactgccctgccacagtggaagcagtcttcctatgcaggcgatgccatc
atcactgccgtgggcctctacgaagggctgtggatgtcttgcgcctctcagagcaccggg
caggtgcaatgcaaactctacgattcactcctggccctggacggtcatatccagtcagca
cgagccctgatggtcgtggctgtgctcctgggctttgtggccatggtgctcagtgtcgtg
ggcatgaagtgcactcgggttggagacagtaaccccactgccaagagccgtgtggccatc
tccggaggtgctctcttcctcttggcaggtctctgtactttgactgctgtctcctggtat
gctaccctggtaacacaggaattcttcaaccccagcactcctgtcaatgccaggtacgaa
tttggcccagctctgttcgtcggctgggcctcggccggcctggccatgctgggcggttcc
tttctctgctgcacatgcccagagccggagagggcgaacagcatcccacagccctatcgc
tctggaccctcaactgctgccagagaacctgttgttaagttgcccgcctcggtcaagggc
cccctgggtgtgtaa

DBGET integrated database retrieval system